KEGG   Bradyrhizobium sp. S23321: S23_00560Help
Entry
S23_00560         CDS       T01796                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    S23_00560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brs02000]
    S23_00560
Enzymes [BR:brs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     S23_00560
Transporters [BR:brs02000]
 Other Transporters
  Pores ion channels [TC:1]
   S23_00560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAL73284
UniProt: I0FXP7
LinkDB All DBs
Position
65124..65720
Genome map
AA seq 198 aa AA seqDB search
MIKLYWSPRSRSFSTLWLMEESGLPYERVLTDISTGAQKAPDFLKVNPMGKVPALSDGDA
ALGEAAAICAYIADRYPETKLAPAVSDPRRARYLQWLFFSPGCIEPAIIQIFTKIEVPSS
TAAWGSATQVFDVLEAALANGPWILGEEFSAADIMIGSGLNFAVRLFKMAPSRPAFEAYI
ARCMARPAFQRAERIAAG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctctattggtcgccgcgctcgcgctcgttctcgacgctctggctgatggaa
gagagcggcctgccctatgagcgcgtgttgaccgacatttcgaccggggcgcagaaggcg
ccggatttcctcaaggtcaatccgatgggcaaggtgccggcgctcagcgacggcgacgcc
gcgctcggcgaggccgcggcgatctgcgcgtacatcgccgaccgctatcccgagacgaag
cttgcgcctgcagtaagcgaccctcgccgcgcgcgctatctgcaatggctgttcttctcg
ccgggctgcatcgagccggcgatcatccagatcttcaccaaaatcgaagtgccgagttcg
accgcggcctggggcagcgcgacacaggtcttcgacgtgctcgaggccgcgctcgccaac
gggccgtggattctcggcgaggagttttcggccgccgacatcatgatcggctcagggctg
aactttgcggtgcgcctgttcaagatggcgccgtcgcgcccggccttcgaggcctatatc
gcccgctgcatggcgcggcccgcgttccagcgcgcggaaaggatcgcagccggctga

DBGET integrated database retrieval system