KEGG   Bradyrhizobium sp. S23321: S23_03900Help
Entry
S23_03900         CDS       T01796                                 

Gene name
sucA
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00020  Citrate cycle (TCA cycle)
brs00310  Lysine degradation
brs00380  Tryptophan metabolism
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
brs01120  Microbial metabolism in diverse environments
brs01130  Biosynthesis of antibiotics
brs01200  Carbon metabolism
Module
brs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
brs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:brs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    S23_03900 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    S23_03900 (sucA)
   00380 Tryptophan metabolism
    S23_03900 (sucA)
Enzymes [BR:brs01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     S23_03900 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: BAL73613
UniProt: I0FYM6
LinkDB All DBs
Position
391924..394887
Genome map
AA seq 987 aa AA seqDB search
MSRQDANAAFALSSFLQGTNATYIDEIYARYEKDPSSVDAEWQEFFKSLKDQPDDVRKNA
QGPSWERDNWPPTPQDDLTSALDGNWAEVEKKVGAKIAAKAQAANKGADFSSADMLQATR
DSVRALMLIRAYRMRGHFHAKLDPLGIEAPRNREELDPRTYGFSEADFDRKIFLDHVLGL
EYANLREITAICERTYCQTLGVEFMHISNAAQKAWIQERIEGPDKEISFTREGRRAILMK
LVEAEGFEKFCDTKFTGTKRFGLDGGEALIPALEQIIKRGGNLGVKEVVLGMPHRGRLNV
LTQVMGKAHRALFHEFKGGSANPDAVEGSGDVKYHLGASSDREFDGNRIHLSLTANPSHL
EIVDPVVLGKVRAKQDQHGDPPDQRISVMPLLMHGDAAFAGQGVVAECFGLSDLKGYRTG
GSVHFIVNNQIGFTTYPRYSRSSPYPSDVAKMIDAPIFHVNGDDPEAVVFAAKVATEFRQ
KFHKPVVIDMFCYRRHGHNEGDEPAFTQPVMYKKIAAHPSTLELYSRRLVSEGVMTQGEV
DKAKADWRARLDAEFEAGTSYKPNKADWLDGKWAGFKIADQEEDARRGVTGVDLPILKDI
GRKITKVPDGFRVHRTIQRFLENRSKAIDGGTGIDWATGEALAFCTLLNENHHVRLSGQD
SERGTFSQRHSVLIDQEDESRYTPFNHLGNEQGHYEVINSLLSEEAVLGFEYGYSLAEPN
TLTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSSARLERY
LQMCAEDNMQVVYPTTPANYFHVLRRQLHREIRKPLIVMTPKSLLRHKRAVSRLEELAKG
TTFHRILYDDAQMLPSEAVKLVPDEKIRRIVLCSGKVYYDLYEEREKRGIDDIYLMRVEQ
LYPVPLKALVAELSRFKKAEVIWCQEEPRNMGAWHFIEPYLEWVLNQVNGVSRRPRYVGR
AASAATATGLMSKHQAQLKAFLDEALS
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccaggacgcgaacgcagcctttgccttgtcatcatttttgcagggcaccaac
gccacctacatcgacgaaatctacgcccgctacgagaaggatccgtcctcggtggatgcc
gagtggcaggagttcttcaagagcctgaaggaccagccggacgacgtccgcaagaacgcc
cagggcccgtcctgggagcgtgacaactggccgccgaccccgcaggacgacctgacctcc
gccctcgacggcaattgggccgaagtcgagaagaaggtcggcgccaagatcgccgccaag
gcccaggcagccaacaagggcgctgatttctcctccgccgacatgctgcaggccacgcgc
gactccgtccgcgcgttgatgctgatccgcgcctaccgcatgcgtggccacttccatgcc
aagctcgatccgctcggcatcgaagctccgcgcaatcgcgaggagctcgacccgcgcacc
tacggcttcagcgaagccgatttcgaccgcaagatcttcctcgatcacgtgctcggtctc
gaatacgcgaacttgcgcgaaatcaccgcgatctgcgagcggacctactgccagacgctc
ggcgtcgagttcatgcatatcagcaatgccgcgcagaaggcgtggatccaggagcgcatc
gaggggccggacaaggaaatctcgttcacccgcgaaggccgccgcgcgatcctgatgaag
ctggtcgaagccgaaggcttcgagaagttctgcgacaccaagttcactggcaccaaacgc
ttcggcctcgacggcggtgaagcgctgatccccgcgctcgagcagattatcaagcgcggc
ggtaatctcggcgtgaaggaagtcgtgctcggcatgccgcatcgcggccgcctcaacgtg
ctgacgcaggtgatgggcaaggcccatcgcgcgctgttccacgaattcaagggcggatcg
gccaatcccgatgctgtcgaaggctcgggcgacgtcaagtaccatctcggcgcgtcctcg
gaccgcgagttcgacggcaaccgcatccatctgtcgctcaccgccaacccctcgcatctc
gagatcgtcgatcccgtggtgctcggaaaggtccgcgccaagcaggaccagcatggcgat
ccgccggaccagcgcatctcggtgatgccgctgctgatgcacggcgacgccgcgttcgcc
ggccagggcgtggtcgcggaatgcttcggcctgtcggacctgaagggctaccgcaccggc
ggctccgtgcacttcatcgtcaacaaccagatcggcttcaccacctatccgcgctactcg
cgctcctcgccctatccgtcggatgtggcgaagatgatcgatgcgccgatcttccacgtc
aacggcgacgatccggaggccgtcgtgttcgcggccaaggtcgcgaccgagttccggcag
aaattccacaagcccgtcgtcatcgacatgttctgctaccgcaggcatggccataacgaa
ggcgacgagccggctttcacccagccggtgatgtacaagaagatcgcggcccatccgtcc
acgctcgagctctattcccgccgcctcgtcagcgaaggcgtgatgacccagggcgaggtc
gacaaggccaaggccgactggcgcgcacggctcgatgccgagttcgaggccggcacctcc
tacaagccgaacaaggccgactggctcgacggcaaatgggccggcttcaagatcgccgac
caggaagaggacgcgcgtcgcggcgtcaccggcgtcgacctgccgatcctgaaggacatc
ggccgcaagatcaccaaggtgccggacggtttccgcgtccaccgtaccatccagcgtttc
ctcgaaaaccgctccaaggcaatcgacggcggcacgggtatcgactgggcgaccggcgag
gcgctggcgttctgcacgctgctcaacgagaaccaccacgtccgactgtcgggccaggat
tcggagcgcggcaccttctcccagcgccactcggtcctgatcgaccaggaagacgagagc
cgctacacgccgttcaaccatctcggcaacgagcagggccattacgaggtcatcaactcg
ctgctgtcggaagaggccgtgctcggcttcgaatacggctactcgctcgccgagccgaac
acgctgacgctgtgggaagcccagttcggggacttcgccaatggcgcgcaggtcgtgttc
gaccagttcatctcctcgggcgagcgcaaatggctgcgcatgtccggtctcgtctgcctc
ttgccgcacggctatgagggccagggaccggagcactcctcggcgcgtctcgagcgctat
ctgcagatgtgcgccgaagacaacatgcaggtggtctaccccaccacgccggcaaattac
ttccacgtgctgcgccgccagctgcatcgcgagatccgcaagccgctgatcgtgatgacg
ccgaagtcgctgctgcgtcacaagcgggcggtctcgcgtctcgaggagctcgccaagggc
acgacgttccaccgcatcctgtatgatgacgcccagatgcttccgagcgaagcggtcaag
ctcgtccccgacgagaagatccgccgcatcgtgctgtgctccggcaaggtctattacgac
ctctacgaggagcgcgagaagcgcggcatcgacgacatctacctgatgcgcgtcgagcag
ctctacccggtgccgctgaaggcgctggtggccgagctgtcccgcttcaagaaggcggaa
gtgatctggtgccaggaagagccgcgcaacatgggtgcgtggcacttcatcgagccgtat
ctggaatgggtgctgaaccaggtgaacggcgtcagccggcgtccgcgttatgtcggtcgc
gccgcttccgccgcgaccgccactggtctgatgtccaaacatcaggcgcagttgaaggcg
ttcctggacgaagcactgagctaa

DBGET integrated database retrieval system