KEGG   Bradyrhizobium sp. S23321: S23_06130Help
Entry
S23_06130         CDS       T01796                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
brs01100  Metabolic pathways
brs01110  Biosynthesis of secondary metabolites
brs01130  Biosynthesis of antibiotics
brs01230  Biosynthesis of amino acids
Module
brs_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:brs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S23_06130
Enzymes [BR:brs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     S23_06130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 AAA_16 RsgA_GTPase AAA_17 AAA_22 CoaE Mg_chelatase MMR_HSR1 AAA AAA_5 ParA
Motif
Other DBs
NCBI-ProteinID: BAL73834
UniProt: I0FZ97
LinkDB All DBs
Position
639154..639777
Genome map
AA seq 207 aa AA seqDB search
MSDAALPIQASPEADILSALGSRSIVLVGMMGVGKSTIGRRLALRLKLPFVDADTEIEAA
AGMTIPEIFEHHGEPHFRDGEARVIARLLDGGPIVLATGGGAFMREETRSRIAAKAVSIW
LKADHDVIMRRVRRRADRPLLQTADPEGTVTRLLTEREPVYAKADLTIASRDVPHDKIVE
ECIETLRAHLCGEQAAQPPADVASAVR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgccgcgttgccgatccaagcttcgcctgaggccgacatcctgtcggcgctc
gggtcgcgctcgatcgtgctcgtcggcatgatgggggtgggaaaatccaccatcggccgc
cgcctggctctcaggctcaagcttcccttcgtcgatgccgacaccgagatcgaggcggcg
gccggcatgaccatacctgagatcttcgagcaccacggcgagccgcatttccgcgacggc
gaggcccgggtgattgcgcgcctgctcgacggcgggccaatcgtgctggcgaccggcggc
ggtgccttcatgcgcgaggagacgcgcagccgcatcgcggcgaaggcggtctcgatctgg
ctcaaggccgatcacgacgtcatcatgcgccgcgtgcgccgccgcgccgaccgcccgctg
ctgcagaccgccgatcccgaaggaaccgtcacgcgcctgctcaccgagcgcgagccggtc
tatgccaaggccgacctcaccatcgcctcgcgcgacgtgccgcacgacaagatcgtcgag
gagtgcatcgagacgctgcgggctcatctgtgcggcgagcaggccgcccaaccacctgcc
gacgtcgcgagtgccgtacgatga

DBGET integrated database retrieval system