KEGG   Bradyrhizobium sp. S23321: S23_07720Help
Entry
S23_07720         CDS       T01796                                 

Gene name
attY
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    S23_07720 (attY)
Enzymes [BR:brs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     S23_07720 (attY)
Transporters [BR:brs02000]
 Other Transporters
  Pores ion channels [TC:1]
   S23_07720 (attY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_2 GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: BAL73992
UniProt: I0FZQ5
LinkDB All DBs
Position
806830..807444
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIALLEAGLPYELVKVDIRAKKLENGEDYLKLNPKGQVPALGLDSG
EIVTEGPVIVQMIADKAAAKALAPAHGSAERYKLLEWLNFLTSEVHKSFGPMFAPALNDE
AKAFFKDRVMGKLKYIDSQLAGRDYLMGKQFTVADGYLFTMLTWADRMKFDFSAMPNLAA
YKARVAARPQVQEALKKEGLAQAA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctattactcgcccggcgcctgctccctgtctcctcacatcgccctcctggaa
gccggcctgccctacgagctggtcaaggtcgatatccgggccaagaagctcgaaaatggt
gaggattatctgaagctgaaccccaaaggtcaggtccccgcgctgggcctcgacagcggt
gagatcgtgaccgaaggtccagtcattgtccagatgatcgccgacaaggccgcggccaag
gcgctggcgcccgcccacggcagcgccgagcgctacaagctgctcgaatggctgaacttc
ctcacctcggaggtgcacaagagcttcggtccgatgttcgcaccggcgctgaacgacgag
gccaaggccttcttcaaggaccgcgtcatgggcaagctgaaatatatcgacagccagctc
gccggccgggactacctcatgggcaagcagttcacggtcgcggacggctatctcttcacg
atgctgacctgggccgaccggatgaagttcgacttttcggcgatgccgaacctcgccgcc
tacaaggcccgcgttgctgcgcgcccgcaggtgcaggaagcgctgaagaaggaagggctg
gcgcaggccgcctga

DBGET integrated database retrieval system