KEGG   Bradyrhizobium sp. S23321: S23_09290Help
Entry
S23_09290         CDS       T01796                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brs00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    S23_09290
Enzymes [BR:brs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     S23_09290
Transporters [BR:brs02000]
 Other Transporters
  Pores ion channels [TC:1]
   S23_09290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: BAL74148
UniProt: I0G061
LinkDB All DBs
Position
985192..985836
Genome map
AA seq 214 aa AA seqDB search
MTDSRRITLYYSPQSRATGTRVLLEELGAPYDLHVLNMKAGEQRKPAYLAVNPLGKVPAI
RHGEALVTEQVAITIYLADLFPRAGLTPALDDPLRGPYLRWIAYYGSSFEPALIDKFMQR
EPAPITQSPYADYDTMLGALETQLSKGPYLLGERMTAADVLWGVAFSWTMMFGIVPKKDV
FVRYADRMTSRPAFQRINAADDEMAAQHAAAIGG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcccgccgcatcaccctgtattattcgccgcagagccgcgccaccggcacg
cgagtgctgttggaggagcttggcgcgccctacgatctccatgtcctcaacatgaaggcc
ggcgagcagcggaagccggcctatctcgccgtcaacccgctcggcaaggtgccggcgatt
cgccatggcgaggcgctcgtgaccgagcaggtcgcgatcacgatctatctcgccgatctg
tttccgcgggcgggtctgacgcctgcgctggacgatccgctgcgcggtccctatctgcgc
tggatcgcctattacggctcgtcattcgagccggccctgatcgacaagttcatgcagcgc
gagccggcgccgatcacgcaatcgccctatgccgattacgacaccatgctgggtgcgctg
gagacgcaactgtcgaaggggccgtatctgctcggcgagcgcatgaccgccgccgacgtc
ctgtggggcgtcgcgttcagctggaccatgatgttcggcatcgtgccgaagaaagacgtt
ttcgtccgctatgccgacaggatgacgtcgcggcccgcgttccagcgcatcaacgcggcg
gatgacgagatggcggcgcagcatgcggccgcgattggggggtag

DBGET integrated database retrieval system