KEGG   Bradyrhizobium sp. S23321: S23_14410Help
Entry
S23_14410         CDS       T01796                                 

Gene name
idnD
Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
brs  Bradyrhizobium sp. S23321
Brite
KEGG Orthology (KO) [BR:brs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    S23_14410 (idnD)
Enzymes [BR:brs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     S23_14410 (idnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: BAL74658
UniProt: I0G1M1
LinkDB All DBs
Position
1519198..1520247
Genome map
AA seq 349 aa AA seqDB search
MTSTSLAATLFGPEDLRMIEHPLDKLADGMVRIRFGAGGICGSDMHYFRHARTGDFVVKS
PLVLGHEISGEVVEISGAAANLKIGDRVAVNPSRWCGHCVACREGRPNLCENIYFMGSAS
KTPHMQGGFANYFDAIPAQCVKIPEHVSYQAAALAEPLAVCLHAVARAGIIEGKRGIIFG
AGPIGLLTMLAARRAGMADITVADIAPTPLAFATRLGASHVENVSAGEEGLKAQAASRPY
DVAFEVSGTAAGLASAIGIVRRGGIVVQIGNLPGGQIPVPANAVMAKEIDLRGSFRFGLE
FMTAVELIGARSVDVLSLVTAERPLSTAPDALRLALDRSQSVKVVLTAN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgacctctctcgccgcaaccctgttcggccccgaagatctccgcatgatcgag
catccgctcgacaagctcgccgacggcatggtgcgtatccgcttcggtgctggcggcatc
tgcggttcggacatgcattacttccgtcatgcccgcactggcgacttcgtggtgaagtcg
ccgctggtgctcggccacgagatctccggcgaggtcgtggagatctccggcgccgcagcg
aacctgaaaatcggcgaccgcgtcgccgtcaacccctcgcgctggtgcggccattgcgtc
gcctgccgcgagggaaggcccaatctctgcgagaacatctacttcatgggctcggcctcg
aagacgccgcacatgcagggtggcttcgccaactactttgacgcgatccccgcgcagtgc
gtgaagattcccgaacatgtctcctatcaggccgcggcgctggccgagccgcttgcggtc
tgcctgcacgcggtcgcgcgcgccggcatcatcgagggcaagcgcggcatcatcttcggt
gccggcccgatcgggcttctgacaatgctcgccgcacggcgcgcgggcatggccgatatc
acggtggcggatatcgcgccgacgccgctcgcctttgcgacccggcttggggcttctcac
gtcgagaacgtctcggcaggcgaggaaggtctgaaggcgcaggccgcatcgcggccttac
gatgtcgcgttcgaagtctcgggcacggctgcgggccttgcgagtgcgatcgggatcgtc
aggcgcggcggcattgtggtgcagatcggcaatctgccgggcggccagattccggtgccg
gccaatgcggtgatggcgaaggagatcgacctgcgcggctcgttccgcttcgggctcgaa
ttcatgacggcggtggagctgatcggcgcccggagcgtcgacgtgctgtcgctggtcacc
gccgagcggccgctgtcgaccgcgccggacgcgctgcgactggcgctcgaccgttcgcag
agcgtcaaggtcgtgctgaccgcgaattga

DBGET integrated database retrieval system