KEGG   Bradyrhizobium sp. S23321: S23_15390Help
Entry
S23_15390         CDS       T01796                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:brs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    S23_15390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:brs03400]
    S23_15390
Enzymes [BR:brs01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     S23_15390
DNA repair and recombination proteins [BR:brs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     S23_15390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S DUF4232
Motif
Other DBs
NCBI-ProteinID: BAL74756
UniProt: I0G1W9
LinkDB All DBs
Position
1617805..1620474
Genome map
AA seq 889 aa AA seqDB search
MLRKLSTYRQKRDFEQTPEPSGRTAVTRSKQRRFVIQKHDATRLHYDLRLEFDGVFKSWA
VTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPEGQYGGGTVMLWDRGTWDCEDPEAGFK
KGDLKFTLHGDKLHGSWVLVRMRNDRTGGKRTNWLLIKHRDEFASESEDILSEDKSVASG
RAMAEIAKGKGRAPKPFMLAKGATTKADAVWQSNRAEETKGRTVKAAPRAALKTSKAAKK
KAMTASTAKEVSEMPDFVAPQLCTLVERPPSGDGWCHEIKFDGYRVQLRIEDGKATLRTR
KGLDWTDKFAAIAKEAATLPDAMIDGEIVALDHHGAPNFSSLQAALSDGKTNELIFFAFD
LLFAEGLDCRRLPLSERKTRLKKLVEAPKKKVSQIRFVEHFESGGDAVLQSACKLELEGI
VSKKLDAPYRSGRTESWTKAKCRAGHEVVIGGWKTTAGKFRSLMAGVHRGDHLAFVGMVG
TGFGADKVKRIMPFLKEAAASKSPFGGKNAPKKTRDVHWLKPELVAEIEFAGFTADGNIR
QAAFKGLRQDKPAEEVEAEAPADIALAKPSAKRRVPAKAAKPSKPSGSAEVMGVVISKPD
KELWPDAGDGEGVSKLDLARYFEAVGAWMIEHLKGRPCSILRAPDGIGGEKFFQRHAMPG
SSNLLELAKVSGDRKPYLQIDRVEGLAAVAQIGGLELHPWNCAPNAYDTPGRLVFDLDPA
PDVDFADVVDAAKEMRQRLTDLGMESFCKTTGGKGLHVVVPLLHGVRDRVSWKEAKAFAQ
GVCQWMADDEPERYLLNMSKKLRNGKIFLDYLRNDRMSTAVGPLSPRARDGATVSMPVTW
AQVKSDLDPKRYTVRTVPGLLARSKAWDGYDDAAASIKAAMKKLAGKKK
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagaaagctatccacctatcgacagaagcgcgatttcgaacagacgccggagccg
tcgggcaggaccgccgtcacacgttcaaagcagcggcgcttcgtgatccagaagcatgat
gcgacccggctgcattacgatctccggctcgaattcgacggcgtcttcaagtcatgggcg
gtgacgaaggggccctcgctcgatccgcacgacaagcggctggcggtggaggtcgaggac
catccgctcgactatggcgatttcgaagggaccatcccggaaggacagtatggcggcggc
accgtgatgctgtgggaccgtggcacctgggactgcgaggatcccgaagccggcttcaag
aagggtgatctgaagttcacgctgcacggcgacaagttgcacggaagctgggtgctggtg
cggatgcgcaacgaccgcaccggtggcaagcgcaccaactggcttctgatcaagcaccgc
gacgagttcgccagtgagagcgaggacattctcagcgaggacaagtcggtggcgtccggc
cgcgcgatggcggagatcgccaaggggaagggccgcgcgccaaaaccgttcatgctggcg
aagggcgccacgaccaaggccgatgcagtctggcagtcgaaccgcgcggaggagaccaaa
gggcgtaccgtcaaagcggcgccccgcgcggcactgaagacctccaaggcggccaagaaa
aaggccatgactgcgtcgactgccaaggaggtctcggagatgccggacttcgtcgcgccg
cagctctgcacgttggttgaacgcccaccgtcgggagatggctggtgccacgagatcaag
ttcgacgggtaccgcgtgcagctccggatcgaggatggcaaggccactctgaggacgcgc
aagggtctcgactggaccgacaagtttgccgcgatcgcgaaggaagccgccacgttgccg
gacgcgatgatcgacggtgagatcgtcgcgctcgaccatcacggcgcaccgaatttttcc
tcgctccaggccgcgctgtcggatggcaagaccaacgagctgatcttcttcgccttcgac
ctgctgttcgccgagggcctcgattgccgccggctcccgctcagcgagcgcaagacccgc
ctcaagaagttggtggaggcacccaagaagaaagtgagccagatccgctttgtcgagcat
ttcgagagcggcggcgatgcggtgctgcaatcggcctgcaagctcgagctcgaaggcatc
gtgtcgaagaagctggatgcgccgtatcgctccggccgcaccgagagctggaccaaggca
aaatgccgcgccggacatgaggtcgtgatcggcggctggaagaccaccgcaggaaaattc
cgctccctgatggccggcgtgcatcgcggcgatcacctcgcctttgtcggcatggtcggc
accggctttggcgccgacaaggtcaagcgcatcatgccgttcctgaaggaggcggcggca
agcaagagtccgttcggcggcaagaatgcgccgaagaagacccgcgacgtgcattggctc
aagcccgagctcgtcgccgagatcgagttcgccggcttcaccgccgatggcaatatccgc
caggccgcgttcaagggcctgcggcaggacaagccggccgaggaggtcgaggcggaagcg
cccgccgatatcgcccttgccaagccctccgcgaaaaggcgcgttccggcgaaggcggcc
aagccgtcgaagccgagtggcagcgccgaagtcatgggcgtcgtgatttccaagccagac
aaggagttgtggccggacgccggcgacggggagggcgtgtcaaagctcgatctcgcccgc
tatttcgaggcggtcggcgcctggatgatcgagcatctgaaaggccgcccctgctcgatc
ctgcgcgcgcccgacggcatcggcggcgaaaaattcttccagcgccacgccatgccgggc
agctcgaacctgctcgaactcgccaaggtctcgggcgaccgcaagccctatttgcagatc
gaccgcgtcgaggggctcgcggcggtcgcacagatcggcggcctcgagctgcatccctgg
aattgcgcgccgaatgcttacgacacgcccggccggctggtgttcgatctcgatccagcg
ccggatgtggatttcgccgatgtcgtcgatgccgccaaggagatgcggcagcgcttgacc
gatctggggatggagagtttctgcaagaccaccggcggcaaggggctacacgtggtggtg
ccgttgctccacggcgtgcgcgacagggtcagctggaaggaagccaaggctttcgcacaa
ggcgtctgccagtggatggcggatgacgagcccgagcgctatctgctcaacatgtccaag
aagctgcgcaacgggaagatctttttggactatctgcgcaacgatcggatgtcgacagcg
gttggaccgctgtctccgcgtgctcgggatggcgcgacggtctcgatgccggtgacctgg
gcacaggtgaagagcgatctcgatccgaagcgctatacggtgcgaaccgtgccgggcttg
ctggcgcgctcgaaggcgtgggatggctatgacgatgcggccgcgtcgatcaaggcggcg
atgaagaagctggcggggaaaaagaagtag

DBGET integrated database retrieval system