KEGG   Bradyrhizobium sp. S23321: S23_19560Help
Entry
S23_19560         CDS       T01796                                 

Definition
(GenBank) hypothetical protein
Organism
brs  Bradyrhizobium sp. S23321
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_C7 TPR_11 TPR_14 Paired_CXXCH_1 TPR_2 TPR_19 Cytochrome_C554 Cytochrom_c3_2 TPR_16 TPR_15 HEAT_2 TPR_20 TPR_5 ANAPC3 Cytochrom_C552 Cytochrom_CIII TPR_12 HEAT
Motif
Other DBs
NCBI-ProteinID: BAL75169
UniProt: I0G332
LinkDB All DBs
Position
complement(2052401..2054770)
Genome map
AA seq 789 aa AA seqDB search
MKARPEQDRSAPAQRPAPTFRLRTAALLAIGSGALFFLVSSGLSWLKTSDISSKPTREAE
LSFIGSQACSGCHQAETRLWQSSQHRHAMDHATDTSVRGDFNGATYDYAGTRSRFFRKDQ
KFLVETDGPDDKLATFEVKYTFGVDPLQQYLVEFPDGRIQALSIAWDTRPKDHGGQRWFH
LYPDAAVTSNDPLHWTRLNQNWNFMCAECHSTDVHKNYDVAKDRFATSFSEISVGCEACH
GAGSRHIAWANQKPGARGPDNGLLVRFDERSGITWPADAGTMAPKRSAPPATLRKEVETC
GRCHARRGQLSEDWVPGRSLSETHRVSLLDRQRFHADGQMRDDEEAYNYASFKQSKMFAE
GVTCSDCHDPHSAALKAPGDGVCAQCHAPAKYESTAHRQHANVSPPPGCASCHMPERRYM
VVDRRHDHGFRIPRPDLSVQLGTPNACNDCHRDKPAAWAVQQIETWFGPERHGFQTYAGA
FHAAWSDTADAQALLAAVVGSSGTPGIVRASALAELPAPDADLIRRALSDPDPLVRLGAL
DALEGIPPDQLWTLASPQLTDPVLGVRIRTAELLASVPPSRQPTADRSKFTQAAAEFVAA
QKLNADRPDARTALGNFLARQASAAEAEAEYRAALRLDPSFSPATINLSDLYRQTGRDDD
GERVLRAALSYSGQNASLHHALGLVLVREKRASEALDELRQAAELDPGQPRYAYVYAVGL
NSSGRRDGALAVLRNSLQAHPNDRDTLSAALALSREKGDLASALGYAEQLSRLMPGNREI
EDLVKQLKQ
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccgacctgaacaagaccgttcggctcccgctcaacgccccgcgccaacattc
cgcttgcgaactgccgctctgctggcaatcggatcgggtgcgttattctttctggtctca
agcgggctgtcctggctcaagacgtccgacatctcgtctaaaccgacccgtgaggcagag
cttagctttatcggcagccaggcatgcagcggctgccaccaggcggagacaaggctgtgg
caaagctcgcaacatcgccatgccatggatcacgcgaccgacacgtcggtccgcggcgac
ttcaacggcgcgacttatgactacgcaggcacgcgctcgcgcttcttccgcaaggaccag
aagtttctggtcgaaacagacggtccggacgacaagcttgcgacgttcgaagtcaaatac
actttcggtgtcgatcccttgcagcaatatctggtcgaatttccagatggtcgcatccag
gccctgtcgatcgcctgggacacgcggccgaaggatcacggcggccagcgctggtttcac
ctctatcccgatgccgccgtcaccagcaacgatcctctgcactggaccagactcaatcag
aactggaatttcatgtgcgccgagtgccactcgacggacgtgcacaagaattacgacgtg
gcgaaggatcggtttgccaccagcttctccgaaatcagcgtcggctgcgaggcctgccac
ggcgcaggctcgcgacatattgcatgggcgaaccagaagcctggagcccgcggcccggac
aacggcctgcttgtccgattcgacgaacgctcaggcatcacctggccagccgatgccgga
accatggctccgaagcgtagcgcgcctccggcaacgttgcgcaaggaagtcgagacctgc
gggcgctgccatgcgcgacgtggacagctctccgaagactgggtgcccggcaggtccctg
tcggagacgcatcgggtgtcgctgctcgatcgccaacgcttccatgccgacggccagatg
cgcgacgacgaggaggcctacaactacgcctcgttcaagcagagcaagatgtttgctgaa
ggcgtcacctgcagcgactgccacgatccgcatagcgcagcgctcaaggcgcccggcgat
ggcgtctgtgcgcaatgccacgcgccggccaagtatgagtctaccgcgcatcggcagcac
gccaatgtgtcgccgccgccaggttgcgcttcctgccacatgcctgaacgtcgctacatg
gtcgtcgatcgccggcacgatcacggcttccgcatcccccgccccgatctctcggtgcag
cttggcacaccgaatgcctgcaacgactgccaccgcgacaagcccgccgcgtgggcggta
cagcagatcgaaacctggttcggtccggagcgccatggttttcagacctatgcaggggca
tttcatgcagcatggagcgacacggccgatgcacaggctctccttgcagccgtcgtcggc
tcaagcggcacccccggaattgtccgcgccagcgcgttggccgagctgcccgcgcccgac
gccgacctgatccgccgcgctctctccgaccccgatccgctcgtgaggctgggcgcgctc
gatgcgctggagggaattccacccgaccagctctggacgcttgcatctccccaattgacg
gacccggtgctcggcgtgcgcatccgcaccgccgagcttcttgcatccgttccgccatcg
cgacaaccgacagccgatcgcagcaagttcacgcaagccgccgccgaattcgtggcggcg
caaaaattgaacgcagatcgtccggacgcccggactgcgctcggtaacttccttgcacga
caggcaagcgccgctgaggccgaggccgaatatcgggcagccctcaggcttgacccatcg
ttctcgccggccaccatcaatctttccgatctctaccggcaaacggggcgcgacgacgat
ggcgagcgagtccttcgcgcagccctatcctactcggggcagaatgcctcacttcaccac
gcgctcggcctcgtgctcgtgcgggaaaagcgcgccagcgaggcgctcgatgaattgcgt
caagcagcagagctggaccccggtcaaccccgctatgcctacgtctatgccgtggggctg
aactcctctggccgccgcgacggcgctcttgctgttctacgaaacagcttgcaagcgcat
cccaatgatcgtgacactctttctgcggcactcgcgctaagccgtgaaaaaggagatctc
gcatccgccttgggctatgctgagcaactctcgcgcttgatgccgggcaatcgcgagatt
gaagatctggtcaagcagctcaagcaatag

DBGET integrated database retrieval system