KEGG   Bradyrhizobium sp. S23321: S23_39240Help
Entry
S23_39240         CDS       T01796                                 

Definition
(GenBank) methyltransferase type 12
Organism
brs  Bradyrhizobium sp. S23321
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 TehB Methyltransf_PK PCMT CMAS
Motif
Other DBs
NCBI-ProteinID: BAL77119
UniProt: I0G8N2
LinkDB All DBs
Position
complement(4006002..4006589)
Genome map
AA seq 195 aa AA seqDB search
MDDATLQFYRSNAQSYADWAKAPSTRLRGFLALLPPGGAILELGCGAGNHSAVMLAEGFS
VRATDGSPEMAEIASQRLGHPVEAMRFDQLEEHEAYDGVWASACLLHVPRDELAGILGRI
HRALKPSGVFYASYKMGESDGRDSLGRYYSYVSPEWLDATYASAGPWITLSSETSVIQSF
DQTPANMLNLVVRKA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggacgatgcgaccctgcaattctatcggagcaacgcccagtcctacgcggattgggcg
aaagcgccttcgacgcggctgcgtggctttctggccctgctgccgccaggcggcgcgatc
ctcgaactcggctgcggcgccggcaatcattcggcggtgatgctggctgaagggttttcg
gtgcgtgcgaccgatggctcgcccgaaatggcggagattgcgtcacagcggctcggtcat
ccggtcgaggcgatgcggttcgaccagcttgaggagcacgaggcctacgacggcgtctgg
gcaagcgcctgtctgctgcatgtgccgcgcgacgaactcgccggtatcctcgggcgaatt
catcgcgcgctgaaaccatcaggcgtgttctatgcgagctacaagatgggcgagagcgac
ggccgcgacagcctcgggcgctactacagctacgtctcgcccgaatggttagatgcgacc
tacgccagcgcggggccgtggatcacgctgtcgtccgagacctcagtgatccagagcttc
gaccagacgccagccaacatgctgaatctcgtcgtccgcaaagcctga

DBGET integrated database retrieval system