Bradyrhizobium cosmicum: S23_41740 Help Entry S23_41740         CDS       T01796                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism brs  Bradyrhizobium cosmicum Pathway brs01100   Metabolic pathways brs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:brs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     S23_41740   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     S23_41740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BAL77369 LinkDB All DBs Position complement(4265162..4265401) Genome browser AA seq 79 aa AA seqDB search MSEIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattggcgagcgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgcagcgagcttcatcgacgaccttggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaagaattcggttgcgagattccggacgatgccgcg gagacgattctcaccgtcggcgacgccacgaagtttctcgagaagaacgcgaagagctaa

DBGET integrated database retrieval system