KEGG   Bradyrhizobium sp. S23321: S23_46940Help
Entry
S23_46940         CDS       T01796                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:brs00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    S23_46940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brs02000]
    S23_46940
Transporters [BR:brs02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    S23_46940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 oligo_HPY SMC_N AAA_29 AAA_16 Mg_chelatase DUF87 AAA_5
Motif
Other DBs
NCBI-ProteinID: BAL77888
LinkDB All DBs
Position
complement(4770781..4772451)
Genome map
AA seq 556 aa AA seqDB search
MSGQLLGISDLHVSFSTRRGMVEAVRGVTLSVDEGEMLGLVGESGSGKSVTGFATTRLLD
AAGRVTGGKIMFRGQDVTKLGGDDLRQLQGAAMSMIFQNPRAALNPIRAIGLQIADAILT
HKKISKDAARAEALELLRAVQIRDPETRMNAYPHELSGGMCQRVMIAIAISCNPSLLIAD
EPTTGLDVTTQKVVMDLLADIAAARGMATILITHDLGLAARYCRRIAVMERGRIVEEASP
KALFSAPQHAYTKRLVAASPTANSRIEDLVTEEEREGYAAVLGKPRQEPAYGTPPLLEVR
KLAKRFDEGSAAVADFSMTMAGGESVGLVGESGSGKSTTSRMICRLIDPSEGDIVFDGQS
IGHIASRDFHRSPLRKDIQMVFQDPNESLNPRFTAFDCIAHPLLRLGGMRAGDALRKRVE
ECAERVGLPLDLLPRFPHQLSGGQKARVGIARAIACRPRLLVLDEPTAALDVSVQAVVLQ
LLDRLRRENDIALLFVSHDLNVVRMLCDRTIVLRNGGIVEQGDSRALFDNPKTDYTRKLV
EAIPHIDTGPALAVAL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcaactgctagggatcagcgacctccacgtctcgttctcgacgcggcgtggc
atggtcgaggccgtgcgcggcgtgacgctctcggtcgacgagggcgagatgctcggcctc
gtcggcgagagtggctcgggcaagtcggtgaccggctttgcaaccacgcggctgctggat
gcggccgggcgcgtcaccggcggcaagatcatgttccgcgggcaggacgtgacgaagctt
gggggagacgacctccgtcagctccagggcgccgcgatgtcgatgatcttccagaacccg
cgggcggcgctcaatccgatccgggcgatcggcctgcagatcgcggacgcgatcctcacg
cacaagaagatatcgaaggacgcggcgcgcgccgaggcgctggagctgctgcgtgccgtc
cagatccgcgaccccgagacgcggatgaatgcctatccgcacgagctctccggcggcatg
tgccagcgcgtgatgatcgcgatcgcgatctcctgcaatccctcgctgttgatcgccgac
gagccgaccaccgggctcgacgtcaccacccagaaggtggtgatggatcttctggcggac
attgccgccgcgcgcggcatggcgacgatcctgatcacgcacgatctcggccttgcggcg
cgctattgccgccgcatcgccgtgatggaacgcggccgcattgtcgaggaggcaagcccc
aaggcgctcttcagcgcgccgcagcatgcctacaccaagcggctggtcgcggcatcgcct
accgcgaattcgcggatcgaagacctcgtgacggaggaggaacgggaaggctacgcggct
gtgctcggcaagccgaggcaggagcctgcgtacgggacgccgccgctccttgaagtgcgc
aagcttgcaaaacgtttcgacgagggttccgcggcagtcgcggatttctcgatgacgatg
gccggcggcgagagcgtcgggctggtcggtgaatccggctccggcaagagcacgacgtcg
cgcatgatctgccggctgatcgatcccagcgaaggcgacatcgtgttcgacgggcagtcg
atcgggcatatcgcgtcgcgcgactttcatcggtcaccgctgcgcaaagacatccagatg
gtcttccaggacccgaacgagagcctcaatccgcgcttcacggcgttcgactgcatcgct
catccgctgctgcggctgggcggcatgcgtgcgggcgacgcgttgcgcaagcgcgtggaa
gaatgtgccgagcgggtcggcttgccgctggatcttctgccgcgcttcccgcatcagctc
tccggcggccagaaggcgcgcgtcggcattgcccgcgccatcgcctgccggccacggctg
ctggtgctggacgagccgactgctgcgctcgacgtctctgtgcaggcggtggtgctgcaa
ctgctcgaccgcctcaggcgcgagaacgacatcgcgctgctgttcgtcagccacgatctc
aacgtggtgcgcatgctctgtgaccgcaccatcgtgctgcgcaacggcggcatcgtcgag
cagggcgacagtcgggcgctattcgacaatcccaagactgactacacgcgcaagctggtc
gaggcgatcccccatatcgacaccgggccggcgctggcggttgcgctttga

DBGET integrated database retrieval system