KEGG   Bradyrhizobium sp. S23321: S23_69070Help
Entry
S23_69070         CDS       T01796                                 

Definition
(GenBank) putative trehalose synthase protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
brs  Bradyrhizobium sp. S23321
Pathway
brs00500  Starch and sucrose metabolism
brs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S23_69070
Enzymes [BR:brs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     S23_69070
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     S23_69070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: BAL80083
UniProt: I0GH46
LinkDB All DBs
Position
7184415..7186112
Genome map
AA seq 565 aa AA seqDB search
MIDDLWYKNGVIYCLSVGTYMDANGDGIGDFKGLLRRLDYLHGLGITTIWLMPFQTSPGR
DDGYDIADYYSVDTRYGTLGDFVEFTHGCKQRGIRVIIDLVVNHTSDQHPWFKEARRDKN
SPYRDWYVWSDKKPAGANQGMVFPGVQKSTWTRDKEAGAWFFHRFYDFQPDLNTSNPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIATKGAKVKKPVEQYDMLRAFREFLQWRKGDAII
LAEANVLPETDMEYFGRDGDRMHMMFNFHVNQHLFYALASGDTRPLAKALKATKPRPAAA
QWGLFLRNHDELDLGRLTKAQRDLVFKRFGPDKDMQLYDRGIRRRFAPMVGGDRRRLELA
YSLMCTLPGTPVIRYGDEIAMGDDLSLPERNCARTPMQWSTEPHGGFTKSDKPACPVIDE
GPYGYEHVNVAKQRRDSNSMLNWTERIVRMRKEVPEIGWGDFAIIATRDPAILIMRYDWR
NNSVLFVHNLDEQPRETAFSVGLPGDAGEHLINLLAEDHSHADKRGQHRIVLEPYGYRWY
RVGGLDYLLKRSDIDESTAGNKHPG
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgatctctggtacaagaacggcgtgatctattgcctgtccgtcggcacctat
atggatgccaacggcgacggcatcggcgacttcaagggtctgttgcggcggctcgattat
ctgcacggcctcggcatcaccacgatctggctgatgccgttccagacctcgccgggccgc
gacgacggctacgacatcgccgactattacagcgtcgatacccgctacggcacgctcggc
gacttcgtcgaattcacccatggctgcaagcagcgcggcattcgcgtcatcatcgatctc
gtcgtcaaccacacctcggaccagcatccctggttcaaggaggcgcggcgcgacaagaac
tcgccctaccgcgactggtatgtgtggtcggacaagaagccggccggcgccaaccagggc
atggtgtttcccggcgtgcagaaatcgacctggacgcgcgacaaggaagccggcgcctgg
ttcttccatcgcttctatgatttccagcccgatctcaacacctcgaacccgcacgtgcag
gccgagatcctcaagatcatgggcttctggatccagctcggcgtttccggcttccgcatg
gacgccgtgcccttcgtgatcgcgaccaagggcgccaaggtaaaaaagccggtcgagcaa
tacgacatgctgcgcgcgttccgcgagttcctgcaatggcggaaaggcgacgccatcatc
ctggccgaagccaacgtgctgcccgagaccgacatggaatatttcggccgcgatggcgac
cgcatgcacatgatgttcaacttccacgtcaaccagcacctgttctacgcgctggcctcc
ggcgacacgcggccgctggcgaaggcgctgaaggcgaccaagccaaggccggccgcggcg
caatgggggctgttcctgcgcaatcacgacgaactggatctgggacggctgaccaaggcg
cagcgcgacctggtcttcaagcgcttcggtcccgacaaggacatgcagctctacgaccgc
ggcatccgccgccgcttcgcgccgatggtcggcggcgaccgcaggcggctcgagctcgcc
tacagcctgatgtgcacgctgccggggacgccggtcatccgctacggcgacgagatcgcg
atgggcgatgatctttcactgcccgaacgcaattgcgcgcgcacgccgatgcaatggtct
accgaaccgcatggcggcttcaccaagagcgacaagccggcatgtcccgtgatcgacgag
ggtccctacggctacgagcacgtcaacgtcgcaaaacagcggcgcgattccaattcgatg
ctgaactggaccgagcgcatcgtccgcatgcgcaaggaggtgccggagatcggctggggc
gatttcgccatcattgcgacgcgcgatcccgcaatcctcatcatgcgctacgactggcgc
aacaactcggtgctgttcgtgcacaatctcgacgaacagccacgcgagaccgcgttctcg
gtgggactgccgggcgatgccggcgaacatctcatcaacctgctcgcggaagaccacagc
cacgccgacaagcgcggccagcaccggatcgtgctggagccgtatgggtaccgctggtac
cgggtgggcgggttggattatctcttgaagcggagcgatatcgacgagagcacggccggc
aacaagcatccggggtga

DBGET integrated database retrieval system