KEGG   Brucella sp. 2002734562: BFS01_02110Help
Entry
BFS01_02110       CDS       T05682                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bru  Brucella sp. 2002734562
Pathway
bru00061  Fatty acid biosynthesis
bru00780  Biotin metabolism
bru01100  Metabolic pathways
bru01130  Biosynthesis of antibiotics
bru01212  Fatty acid metabolism
Module
bru_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BFS01_02110
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BFS01_02110
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BFS01_02110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bru01004]
    BFS01_02110
Enzymes [BR:bru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BFS01_02110
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BFS01_02110
Lipid biosynthesis proteins [BR:bru01004]
 Fatty acid synthase
  Component type
   BFS01_02110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AOG43193
LinkDB All DBs
Position
1:442178..442996
Genome map
AA seq 272 aa AA seqDB search
MTAQSGLLQGKRGLILGVANNRSIAWGIAKAAREAGAELAFTYQGDALKKRVEPLAEELG
AFVAGHCDVADAASIDAVFETLEKKWGKLDFLVHAIGFSDKDELTGRYIDTSEANFTNTM
LISVYSLTAVSRRAEKLMADGGSILTLTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDL
GPQNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIDEVGDVGLYFLSDLS
RSVTGEVHHADSGYHVIGMKAVDAPDISVVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacagtctggtttgttgcagggcaagcgtggattgattctaggcgtggccaat
aatcgctctatcgcttggggcattgcaaaagccgcccgtgaagctggcgcagagcttgca
ttcacctatcagggtgacgcattgaagaagcgtgtggagccgctggccgaggagcttggc
gccttcgtcgccggacattgcgacgtcgccgatgcggcgagcatcgatgcggtttttgaa
acgcttgagaagaagtggggcaagctcgacttcctggtgcacgcaatcggtttctccgac
aaggacgagctgaccggccgctatatcgatacgtcggaagccaatttcaccaatacgatg
ctgatttcggtctattcgctgacggcggtttcgcgccgcgcggaaaagctgatggccgat
ggcggatcgattctgacgctgacctattacggcgctgaaaaggtcatgccgaattacaat
gtcatgggcgtggccaaggcagcccttgaggcgagcgtgaaatatctggccgtcgatctt
ggcccccagaacattcgcgtcaatgcaatctcggctggccccatcaagacgcttgccgct
tccggcattggtgacttccgctatatcctgaagtggaacgaatataatgcgccgctgcgc
cgcaccgtcacgatcgacgaggtgggtgatgtcggcctttatttcctttcggacctgtcg
cgttcggttacaggcgaagtgcaccatgccgacagcggctatcatgtcattggcatgaaa
gcggttgacgcaccggatatctcggtcgtgaaagactga

DBGET integrated database retrieval system