KEGG   Brucella sp. 2002734562: BFS01_09240Help
Entry
BFS01_09240       CDS       T05682                                 

Definition
(GenBank) NTP pyrophosphohydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bru  Brucella sp. 2002734562
Brite
KEGG Orthology (KO) [BR:bru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bru03400]
    BFS01_09240
Enzymes [BR:bru01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BFS01_09240
DNA repair and recombination proteins [BR:bru03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BFS01_09240
 Prokaryotic type
    BFS01_09240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4 NUDIX_2
Motif
Other DBs
NCBI-ProteinID: AOG44454
LinkDB All DBs
Position
1:complement(1884293..1884709)
Genome map
AA seq 138 aa AA seqDB search
MTEVKKRRMLLVVACALVDQDGRVLLAQRPVGKQLAGLWEFPGGKVEPGETPEETLIREL
QEEIGITTKIPCLAPLTFASYTYDDFHLLMPLYVCRRFEGVARGLEGQALKWVRPKDMRD
YPMPPADEPLIPFLVDLL
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtgaagaaacggcgcatgcttcttgtcgtggcctgtgcccttgtggatcag
gacgggcgggtgcttctggcgcagcgtcccgtaggcaagcagcttgcgggcctgtgggaa
tttcccggcggcaaggtggagccgggtgagacgccggaagaaaccctgattcgcgaattg
caggaagagatcggcatcacgacaaaaatcccctgcctcgcaccgctgactttcgcgagt
tacacatatgatgattttcaccttctgatgccgctctatgtctgccgccgtttcgagggc
gttgcgcgcgggctggaagggcaggcgctgaaatgggtgcgcccgaaggacatgcgcgat
tatccgatgcctccggcggatgagccgctcattccgtttctggtcgatctgctttga

DBGET integrated database retrieval system