KEGG   Brachybacterium sp. VR2415: CFK39_01580Help
Entry
CFK39_01580       CDS       T04950                                 

Gene name
cydC
Definition
(GenBank) thiol reductant ABC exporter subunit CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
brv  Brachybacterium sp. VR2415
Pathway
brv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:brv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CFK39_01580 (cydC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brv02000]
    CFK39_01580 (cydC)
Transporters [BR:brv02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    CFK39_01580 (cydC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_29 SMC_N AAA_25 FtsK_SpoIIIE AAA_22 NACHT RsgA_GTPase AAA_33 DUF87 MMR_HSR1 Mg_chelatase DLIC Zeta_toxin CbiA
Motif
Other DBs
NCBI-ProteinID: ASK64746
UniProt: A0A220UA12
LinkDB All DBs
Position
347815..349488
Genome map
AA seq 557 aa AA seqDB search
MSAPSSTALRQAVRALEIPRTRLLAAVLASLATLGSAFALAAVAAYLVTRAWTMPPVLDL
TIAVVAVRALGVSRGAFRWLERMLTHDVALRGVVSLRTNLFTAVAARTDDALTRLRRGDL
LARLGDDAQELGDHVITALVPTLVSVVMAVAVLATFAPLSLSAAAVMLTSLALASVLAPL
AAHRASRISEQAVLTTRAGLSAQALEILDDATSLRVQGRLEGSLAELGQRQAAHDDAIDR
AAVPAAVASAAVPLTMILAVTGSLLAAGSLWADGGASAGQIGVLLLLPLSSFEAATALPA
AASQHARSQAAAARLAELAGPPAAAVPSAPAPARRAEAELRAVGLTAGWSPQTPRVRALD
LELPAGSRLAVVGASGSGKSTLLATLAGLLDPLAGHVELDGQDLAALDPAAVRAGVTMFA
EDGHVFATTVRENLRVVRGDLGDQEIRAALAAVGLVDWVAALPRGLDTMLGPDGTTISGG
ERRRLLLARAVVRGGPVLLLDEPTEHLDTERGDALLHALLTPQDTTLVPTSSTVVVVTHR
IEAIPAGTSILRLEDHR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccctcctcgaccgccctgcggcaggcggtgcgcgcgctggagatcccccgc
acccggctgctcgccgccgtgctcgcctcgctggcgacgctcggctccgccttcgccctg
gccgcggtcgccgcctatctcgtcacccgggcctggacgatgccgccggtcctggacctc
accatcgccgtggtggcggtccgggcgctcggcgtctcccgtggagcgttccgctggctg
gagcggatgctcacccatgacgtcgccctgcggggcgtggtctccctgcgcacgaacctg
ttcaccgcagtggccgcgcgcaccgatgatgcgctgacccggctgcggcgaggagatctg
ctggcccgactcggggatgatgcccaggagctcggcgaccacgtcatcaccgccctggtg
ccgacactggtctcggtggtgatggcggtggcggtgctcgcgaccttcgcgccgctgtcc
ctgtccgccgccgcggtgatgctcacctccctggcgctcgcgagcgtgctcgccccgctg
gccgcccatcgggcatcgaggatctccgagcaggcggtgctcaccacccgcgccggtctc
agcgcgcaggccctggagatcctcgacgacgccacctccctgcgcgttcagggccggctc
gaggggtcgctggccgagctggggcagcggcaggcggcgcacgacgacgcgatcgatcgg
gcggcggtgcccgcggcggtggcctccgccgcggtgccgctgacgatgatcctggcggtg
accggcagcctgctggcggccgggtcgctgtgggccgacggcggggcctcggccgggcag
atcggtgtgctgctcctgctgccgctgtcctccttcgaggcggccactgctctgcccgcg
gcggcctcgcagcacgcccgctcccaggccgcggccgcacggctggccgagctggccggc
ccacctgcggcggcggtcccctcggcacccgctcccgcgcggcgcgcggaggccgagctg
cgcgcggtggggctcacggccggctggtccccgcagactccgcgggtgcgggcactggac
ctcgagctcccggccggctcccggctggcggtggtcggtgcctccgggagtgggaaatcc
accctgctggccactctcgccggcctgctggatccgttggccgggcacgtcgagctcgac
ggacaggacctcgccgccctcgatcctgccgcagtgcgggcgggagtgacgatgttcgcc
gaggacgggcacgtcttcgccaccacggtgcgggagaatctgcgggtggtgcgcggagac
ctcggcgaccaggagatccgggcggcgctggcggccgtgggcctggtcgactgggtcgcg
gcgctgccacgcggcctggacacgatgctcggcccggacggcaccaccatctccggtggt
gagcggcgccggctgctgctggcccgcgccgtggtgcgcggtggaccggtgctgctgctg
gacgagcccaccgagcacctcgacaccgagcggggcgacgcgctgctgcatgccctgctg
accccgcaggacaccacgctggtgcccacgagcagtaccgtcgtggtggtcacccaccgc
atcgaggcgatcccggccgggacctcgatccttcgactcgaggaccaccgatga

DBGET integrated database retrieval system