KEGG   Brachybacterium sp. VR2415: CFK39_11665Help
Entry
CFK39_11665       CDS       T04950                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brv  Brachybacterium sp. VR2415
Pathway
brv00620  Pyruvate metabolism
brv00680  Methane metabolism
brv01100  Metabolic pathways
brv01120  Microbial metabolism in diverse environments
brv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:brv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFK39_11665
  09102 Energy metabolism
   00680 Methane metabolism
    CFK39_11665
Enzymes [BR:brv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CFK39_11665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ASK66366
UniProt: A0A220UEN5
LinkDB All DBs
Position
2609089..2611917
Genome map
AA seq 942 aa AA seqDB search
MPDPDAIAVPTLTSEFPVVGDDPHIDAPLRATVRRLSTLLGGALADQHGQEMLDLVEQVR
KLTKEAKSSESEGSALDVQNRLAELPIEQATTLTRAFSQYFLLANAAEQVYRVRALDERP
AADSWMPRTVRAIHEELGADGLQKAMDSLDVRLVFTAHPTEASRRAVLTKLRRISDILGV
ETEEGSVERRRQDRDLAELIETLWQTDELRRQRPTPQDEARNALYYLRQIFRQTMPEMLD
DLREELREHGAQMRDDQVPLRFGSWIGGDRDGNPFVTAQVTREVLELQAETAIDFAVEVI
SDLILELSVSSELTGVDEQLMESLREDLSQGSEIDPVQQELYRQEPYRLKLGAMRSKLRA
TQERISTGDGHVHGRDYSDSSELQDDFRVLREALRRHGGERVADGALAVAQQVLAASGLN
LATLDVREHSEKHHDVLARLFDRVGELDRPYMELSRQERTAVLGRELGSRRPLVGSAITE
DESVLDDPTRTTYNVFREIRDAHRLYGTSVIETYIISMTHGSDDVLAAALLAREAGLISI
AGSEERRADIGFVPLLEEVSELRHAGEILDQLLSDPSYREIVNLRGDRQEVMLGYSDGNK
DAGVITSQWEIHQAQRSLRDAAARHGVTLRLFHGRGGSVGRGGGPTYDAILAQPYGVLEG
EIKFTEQGEVISDKYMLPSLARENLDLSLAAVLEGSALHTSPRTPAQTMDHFGEVMQSVS
DAAFSRYRTLVDDENLPEYFVSATPVEQLGDLNIGSRPSKRTTSEKGLEGLRAIPWVFGW
TQSRQIVPGWFGAGSGLKAAREAGLEPDLHEMYRNWHFFRTVISNVEMTLAKTDMQIAAH
YVHSLVPERLWYLFDRIRAEYELSVAEIERLTGVLGLLDNQPILKRTLAVRDRYLDPISY
MQVAMLQRARAATERGEELSPELQRALLTTINGVAAGLKNTG
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
gtgccagatcccgacgctatcgccgtccccacgttgacgagcgagttccccgtcgtcggc
gacgacccccatatcgacgccccgctgcgagccaccgttcgccgcctgtccaccctgttg
ggcggcgccctcgccgaccagcacggccaggagatgctcgacctcgtcgagcaggtccgc
aagctcaccaaggaggcgaagtcctccgagtccgagggcagcgccctcgacgtccagaac
cgcctcgccgagctgcccatcgagcaggccaccaccctgacccgggcgttcagccagtac
ttcctgctggccaacgccgcggagcaggtctaccgggtgcgggcgctcgacgagcgccct
gccgccgactcctggatgccgcgcaccgtgcgcgccatccacgaggagctcggcgccgac
ggtctgcagaaggcgatggactcgctcgacgtgcgcctggtcttcaccgcgcatcccacc
gaggcctcccgccgcgctgtgctgaccaagctgcgccgcatctcggacatcctcggcgtg
gagaccgaggagggctccgtcgagcggcggcgccaggaccgtgatctcgccgagctcatc
gagacgctctggcagaccgacgagctccgccgccagcgccccaccccgcaggacgaggcg
cgcaacgccctctactacctgcgccagatcttccgccagacgatgccggagatgctcgac
gacctccgcgaggagctgcgcgagcacggtgcgcagatgcgcgacgaccaggtgccgctg
cgcttcggctcctggatcggcggcgaccgcgacggcaaccccttcgtcaccgcccaggtc
acccgcgaggtgctggagctgcaggcggagacggcgatcgacttcgccgtcgaggtcatc
tccgatctgatcctcgagctctcggtctccagcgagctgacgggcgtggacgagcagctg
atggagagcctgcgggaggatctctcccagggctccgagatcgacccggtccagcaggag
ctctaccgccaggagccctaccgcctcaagctcggcgcgatgcgctccaagctgcgcgcc
acccaggagcgcatcagcaccggggacggtcacgtccacggccgggactacagcgacagc
tccgagctccaggatgacttccgggtactgcgcgaggcgctgcgccggcacggcggagag
cgcgtcgccgacggtgccctcgccgtcgcccagcaggtgctcgcggcctccggtctcaac
ctggccaccctcgatgtgcgcgagcactccgagaagcaccacgacgtgctggcgcgtctg
ttcgaccgggtgggcgagctggatcgcccctacatggagctcagccggcaggagcgcact
gcggtgctggggcgcgagctcggcagccgtcggccgctggtgggatccgcgatcaccgag
gacgagtcggtcctcgacgatccgacccgcaccacctacaacgtgttccgggagatccgg
gacgctcaccgcctctacggcacctccgtcatcgagacctacatcatctcgatgacccac
ggcagcgacgacgtgctcgcagccgcgctgctcgcccgcgaggcggggctgatcagcatc
gccggcagcgaggagcgtcgtgccgatatcggcttcgtcccgctgctcgaggaggtctcg
gagctgcgccacgccggcgagatcctcgaccagctgctcagcgatccctcctaccgggag
atcgtgaacctgcgcggcgaccgccaggaggtcatgctcggctactccgacggcaacaag
gacgccggcgtgatcaccagccagtgggagatccaccaggcccagcgctcgctgcgcgat
gcggcggcccgccacggggtgaccctgcggctgttccacggtcgcggcggttccgtcggc
cgcggcggcggtcccacctatgacgcgatcctggcccagccgtacggcgtgctcgagggc
gagatcaagttcaccgagcagggcgaggtcatctccgacaagtacatgctgccctcgctg
gccagggagaacctggacctgtcgctggccgcggtgctcgagggctcggccctgcacacc
tctccgcgcaccccggcgcagaccatggaccacttcggcgaggtcatgcagtcggtctcc
gacgcggcgttctcccggtaccgcacgctggtcgacgacgagaacctgccggagtacttc
gtctccgccaccccggtggagcagctgggcgatctgaacatcggctcgcggccctcgaag
cgcaccacctcggagaagggcctggagggcctgcgggcgatcccgtgggtgttcggctgg
acccagtcgcggcagatcgtgcccggctggttcggtgccggctccggtctgaaggcggcg
cgcgaggccgggctcgagcccgatctgcacgagatgtaccgcaactggcacttcttccgc
accgtgatcagcaacgtcgagatgacgctggcgaagacggacatgcagatcgctgcccac
tacgtgcactcactggtgcccgagcggctgtggtacctcttcgaccggatccgggcggag
tacgagctctcggtggcggagatcgagcggctcaccggtgtgctgggtctgctggacaac
cagccgatcctcaagcgcaccctggccgtgcgcgaccgctacctggatccgatctcctac
atgcaggtcgcgatgctgcagcgggcccgggccgccacggagcggggcgaggagctctcg
cccgagctgcagcgcgcgctgctgaccaccatcaacggcgtcgccgcggggttgaagaac
accggctga

DBGET integrated database retrieval system