KEGG   Brachybacterium sp. VR2415: CFK39_15090Help
Entry
CFK39_15090       CDS       T04950                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
brv  Brachybacterium sp. VR2415
Brite
KEGG Orthology (KO) [BR:brv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:brv01001]
    CFK39_15090
Enzymes [BR:brv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CFK39_15090
Protein kinases [BR:brv01001]
 Serine/threonine kinases: Other
  Bacterial family
   CFK39_15090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr Pkinase_fungal APH Kinase-like Haspin_kinase RIO1
Motif
Other DBs
NCBI-ProteinID: ASK66909
UniProt: A0A220UFJ4
LinkDB All DBs
Position
complement(3369375..3371513)
Genome map
AA seq 712 aa AA seqDB search
MSSATSTSPGISQLLDDRYRVEELIARGGMATVHRGHDERLDRVVALKIMHPHLAMDEDF
RRRFGREARAAARLAHRNVVGVFDQGEDEDRIYLAMELVEGETLRARLVAQERLALRESL
EITIQVLQALVAAHEAGIVHRDIKPENILIDHDDLVKVADFGLARATGSNNSSASAALLG
TVAYISPEVVTRGHADERSDLYSLGIVLFEMLTGRQPFLGEQPVHIAFQHVHEDIPAPSS
LVTGIPRELDSLVTWAAARQVEQRPATAADLLRAVRELAATLPTSVLASRPQVREMTDTS
DVPQMTTSLEEVASALDHGPRTFPADLLAPNGDDDPEAGDDGDSSTSPTSLDRARAEDDS
AQPAAAPGIGDAEDTGDAEDAEDAEDAEDDDARRVVVLRAPRTPRGRHLPHGARRRSRPM
AILAALSLIAALAFGAWAGGDWYLNTGPGADRTVPLVVGTPLADAEGALTAAGLSVSTAE
QFDDSVPAGHVISASPSTGSTVKKGADIHVVVSKGEQTFPVPQVVGHGLEDARTEVEALG
LELVEDDPVHSETVPEGEVVSQSASADALPAGGEVHIVLSQGRQPLTVPDQTGRSGESAR
AALEDAGFSVTSAQAHSGSVPRGAVISQSPASGTLFRGDTVHLVTSLGPEMVTVPDVFRA
PEADAKATLEGAGFTVEVVHDKGEPAFGLVYEQSAAAGSELEKGSTITLKVF
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
gtgagttcggcgacgtcgacttcccccggcatcagccagctcctcgacgaccgttaccgg
gtcgaggagctcatcgcgcgcggcggaatggcgaccgttcatcgcggtcacgatgaacgg
ctcgaccgcgtggtcgcgctgaagatcatgcacccccatctggcgatggacgaggacttc
cgccgacggttcggacgggaggcgcgagcggccgctcgcctggcccaccgcaacgtggtc
ggcgtgttcgaccagggcgaggacgaggatcgcatctatctcgcgatggagctggtcgag
ggcgagaccctccgggcccgcctcgtcgcccaggagcggctcgccctccgcgagagcctc
gagatcacgatccaggtgctgcaggcgctggtggccgcgcacgaggccggcatcgtccat
cgcgatatcaagcccgagaacatcctcatcgaccacgacgatctggtgaaggtcgccgac
ttcgggctggcccgcgccaccggttcgaacaactcctcggccagcgcggcactgctgggg
acggtcgcctacatcagcccggaggtggtcacccgcgggcacgccgacgagcgcagcgat
ctgtactccctcgggatcgtgctgttcgagatgctcacgggccgtcagcccttcctgggc
gagcagccggtccatatcgcgttccagcacgtccacgaggacatccccgcaccctcgtcc
ctcgtcaccggcatcccccgcgagctcgactcgctggtcacctgggccgccgcacggcag
gtcgagcagcgccccgccaccgcagcggacctgctgcgtgcggtgcgggagctcgctgcg
accctgccgaccagcgtgctcgcgtcccggccgcaggtgcgggagatgaccgacacctcc
gatgtcccgcagatgaccacctccctcgaggaggtcgcctccgcgctcgatcacggtccg
cgcaccttccccgccgatctgctcgccccgaacggggatgacgacccggaagcgggcgac
gacggtgactcctccacctcccccacctccctcgaccgagcgcgggccgaggacgattcc
gcacagccggccgccgcgccggggatcggcgacgctgaggacactggcgacgctgaggac
gctgaggacgctgaggacgctgaggacgacgatgctcggcgggtcgtggtgctgcgcgcg
ccgcgcacgccccgcgggcgccatctgccccacggggcccgtcggcgctcacggccgatg
gccatcctcgccgcgctgagcctgatcgccgcgctcgcgttcggcgcctgggcaggcggc
gactggtacctgaacaccggaccgggcgcagatcggaccgtcccgctggtggtcgggacc
ccgctggccgacgccgagggcgcactcacggcggccggcctgtccgtcagcaccgctgag
cagttcgacgactccgtgcccgccgggcacgtcatctccgcctccccctctaccgggagc
accgtcaagaagggtgccgacatccacgtggtcgtctccaagggggagcagaccttcccg
gtcccccaggtggtcggccacggcctcgaggacgcccgcaccgaggtcgaggcgctcggg
ctggagctggtggaggacgatccggtgcactcggagaccgtccccgagggcgaggtcgtc
tcccagtccgcctccgccgatgcgctccccgcaggcggcgaggtgcacatcgtcctctcc
caggggcgccagcccctcacggtccccgatcagaccggccgcagcggggagagcgcccgt
gccgccctcgaggacgccggcttctcggtcaccagcgcgcaggcgcattccggcagcgtg
ccccgcggcgcggtcatctcccagtcccccgcctccggaacgctgttccgcggcgacacc
gtccacctggtcacctccctcggcccggagatggtgacggtgccggacgtgttccgcgca
cccgaggcggacgcgaaggccacgctcgaaggtgccggcttcacggtcgaggtcgtgcac
gacaagggagaaccggccttcgggctggtctacgagcagtcggccgccgccggatcggag
ctcgagaagggctcgaccatcaccctgaaggtcttctga

DBGET integrated database retrieval system