KEGG   Brachybacterium sp. VR2415: CFK39_15180Help
Entry
CFK39_15180       CDS       T04950                                 

Definition
(GenBank) DNA topoisomerase IV
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
brv  Brachybacterium sp. VR2415
Brite
KEGG Orthology (KO) [BR:brv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:brv03032]
    CFK39_15180
   03400 DNA repair and recombination proteins [BR:brv03400]
    CFK39_15180
Enzymes [BR:brv01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     CFK39_15180
DNA replication proteins [BR:brv03032]
 Prokaryotic type
  DNA Topoisomerases
   CFK39_15180
DNA repair and recombination proteins [BR:brv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      CFK39_15180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C Tho1_MOS11_C
Motif
Other DBs
NCBI-ProteinID: ASK66926
UniProt: A0A220UG99
LinkDB All DBs
Position
complement(3388231..3390699)
Genome map
AA seq 822 aa AA seqDB search
MMACMARSRSTTPPSGEEAVEETIVDIDVTSEMETSFLEYAYSVIYSRALPDARDGLKPV
QRRILFMMAEMGLRPEKGHVKSQRVVGEVMGKLHPHGDTAIYDALVRMAQSFNMRMPLVD
GHGNFGSLDNGPAAPRYTEARLAKAALLMTDSLDEDVVDMIPNYDNQLLQPEVLPAQYPN
LLVNGASGIAVGMATNMAPHNLVETIAAARHLIDHPDAELEELMRFVPGPDLPTGGRIVG
LDGIRDAYRTGRGSFKMRATTRIENVTSRRKGIVVTELPYQVGPERLAEKLRDAVQAKRV
QGITDYQDFTDRHHGLRLVLTVKSGFDPDAVLAQLYKYTPLEESFGINNVALVEGQPRTL
GLKQMLEVFVEHRVTVVRRRTEHRLSRRRARLHLVEGLLLAILDIDEVIQIVRQSDDAET
ARTRLMTVFDLSELQAEYILELRLRRLTKFSQIDLEAERDDLRREIERLEEILGSEVVLR
ALVSEELAAVAAEHGDSRRTVLLEAAEKPAVVSGASLEVADEPCRVLLTGTGLIARITGG
DPLLREGPRGAHDVIVSDARTTTRSSVGVVTDRGRVLRLSVVDLPSLAPTAGAPSLAGGT
RLSDLIDLEREERALGLIRVAEPDIARGGAIAVGTRQGVVKRVQLDFPRGDGFEIISLKD
GDAVVGVVDLEQDEDLDLVFVTAEAQLLHFPASGIRPQGRTAGGVAGVKLASGDRVVSFG
AIDVTAPADVVTVAGSSGTLPLLQTGSLKVSALTEFPAKGRATAGMRCHRFLRGEDALIG
AWVVPHPARASSEAGQPIDLPEPTGRRDGSGTPVAVPIAAVG
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgtgcatggcccgatcacgcagcaccaccccgccctccggagaggaagccgtc
gaggagaccatcgtcgacatcgacgtcaccagtgagatggagacgtcgttcctggagtac
gcgtattccgtgatctactcccgggcgctcccggatgcccgcgacgggctcaagcccgtc
cagcggcgcatcctcttcatgatggccgagatggggctgcgtcccgagaagggccatgtg
aagagccagcgcgtggtcggcgaggtgatgggcaagctccatccccacggcgatacggcg
atctacgacgcgctggtgcgcatggcgcagagcttcaacatgcgcatgccactggtggac
ggccacggcaacttcggctcgctggacaacggccccgccgcgccgcgctacaccgaggcg
cggctggcgaaggccgcgctgctgatgacggactcgctggacgaggacgtcgtggacatg
atccccaactacgacaaccagctgctgcagcccgaggtgcttcccgctcagtatccgaat
ctgctggtcaacggggcctccggaatcgcggtcggcatggccacgaacatggcgccgcac
aacctcgtggagaccatcgccgcggcgcggcacctgatcgaccatcccgacgcggagctc
gaggagctgatgcgcttcgtcccgggaccggacctgcccaccggcggacggatcgtgggt
ctggacggcatccgggacgcgtaccgcaccgggcgcggctcgttcaagatgcgggccacc
acccggatcgagaacgtcacctcgcgtcgcaagggcatcgtggtcaccgagctgccgtac
caggtgggcccggagcgactggccgagaagctgcgcgacgccgtgcaggccaagcgggtc
cagggcatcaccgactaccaggacttcaccgaccgccaccacggcctgcgcctggtgctc
acggtcaagtcgggcttcgaccccgacgcggtgctggcgcagctgtacaagtacacgccg
ctggaggaatcgttcggcatcaacaacgtggccctggtcgaggggcagccgcgcaccctg
gggctcaagcagatgctggaggtgttcgtcgagcatcgggtgacggtggtccgccgccgc
accgagcaccggctgagcaggcgcagggcgcgcctccacctggtggaggggctgctgctg
gcgatcctggacatcgacgaggtgatccagatcgtgcgtcagagcgacgatgccgagacc
gcgcgcacgcgcctgatgaccgtcttcgacctctccgagctccaggccgagtacatcctc
gagctgaggctgcggcggctgacgaagttctcgcagatcgatctggaggccgagcgggat
gatctgcgccgggagatcgagcgtctcgaggagatcctggggtccgaggtcgtgctgcgc
gcgctggtctccgaggagctcgccgccgtggccgccgagcacggcgattctcgccgcacc
gtgctgctggaggccgcggagaagcccgccgtggtctccggggcgtccctcgaggtggcc
gatgagccgtgccgggtgctgctgaccgggaccgggctgatcgcccggatcaccgggggg
gacccgctgctgcgcgagggaccgcgcggtgcgcacgacgtgatcgtctccgatgcccgc
accaccacccgctcgagcgtcggcgtggtcaccgatcgtgggcgggtgctgcggctgtcc
gtcgtggacctgccctcgctcgccccgacggccggtgcgccgtcgctggccggaggcacg
cggctctccgacctgatcgatctggagcgcgaggagcgggccctgggcctgatccgggtg
gccgagcccgatatcgcgcggggcggggcgatcgccgtgggcacccgccagggtgtggtc
aaacgggtccagctcgacttcccccgcggggacggcttcgagatcatctcgctcaaagac
ggggacgcggtggtcggggtcgtggatctcgagcaggacgaggacctcgacctggtgttc
gtcaccgccgaggcgcagctgctccacttccccgcctccggcatccggccgcagggccgc
accgccggcggggtggccggggtcaagctcgcgagcggcgaccgggtggtgtccttcgga
gcgatcgacgtgacggctccggccgacgtggtcaccgtcgccggcagctcaggcaccctg
ccgctgctgcagaccggctcgctgaaggtctccgcgctcaccgagttccccgccaagggc
cgtgccacggccggaatgcgctgccatcgcttcctgcgcggtgaggacgcgctgatcggt
gcctgggtggtgccgcacccggcacgagcctcgtccgaggccgggcagccgatcgatctg
ccggagccgacgggacgccgggacggttcgggcaccccggtggccgtccccatcgccgcc
gtcggctga

DBGET integrated database retrieval system