KEGG   Brachybacterium sp. P6-10-X1: BH708_01625Help
Entry
BH708_01625       CDS       T04713                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
brx  Brachybacterium sp. P6-10-X1
Brite
KEGG Orthology (KO) [BR:brx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:brx01001]
    BH708_01625
Enzymes [BR:brx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BH708_01625
Protein kinases [BR:brx01001]
 Serine/threonine kinases: Other
  Bacterial family
   BH708_01625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Pkinase_fungal APH Kinase-like RIO1 Kdo Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: APX31627
UniProt: A0A1P8NBD2
LinkDB All DBs
Position
complement(365583..367760)
Genome map
AA seq 725 aa AA seqDB search
MSAATSTSPGISLLLDDRYRVEEQIARGGMATVHRGHDERLDRVVALKIMHPHLAADEDF
RRRFGREARSAARLAHRNVVGVFDQGEDEDRIYLAMELVEGETLRARLVEQGRLSIRETL
QVTEQVLEALVAAHAAGIVHRDIKPENILLDPDDVVKVADFGLARAIGASNSSASATLLG
TVAYISPEVVTRGHSDERSDLYSLGVVLFEMLTGRQPFVGEQPVHIAFQHVHEDIPAPST
RVTGLPRELDSLVTWAASRVVEQRPATAAELLAAVRELTDSLPGPVLDRRPVPREDGDTG
DVPRPTSPLEDVVAELHGGPRAFPAGLLPGTGDAPSSALLPSAGGESLATQTGDDAPQGT
AEAETAGAPTGPDDEDRGEDVARADDAARTDAADGGEGTGEEDAGRRTVVMRAPKGRRGR
HLPPGTRHRSRPVAVLAALSLLAALFTGAWAGGDWYLNTGPGADRTIPVLAGTELSDAEA
VLAASDLGVTTRQTFDETVPAGHVIAADPGAGTTVKKGTNIEVVVSKGVETFPVPDLVGA
ELDSAAQEVEELGLVLVEEDPEYSETVPAGEVISQSQEAEALPAGGEVHVVASQGPRPIT
IDDQTGKSGEAARSALESAGFAVAASSAHSANVPAGAVISQSPSSGTGHRGDTVTLVTSL
GPEMVTVPDVFRQSEAEAKKTLEAAGFDVTVRHDRGEPVFGLVYEQSAAAGTEVAKGSAI
TITVF
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcggcgacgtcgacttcccccggcatcagcctgctcctcgacgaccgctaccgg
gtcgaggagcagatcgcgcgcggcggaatggcgacggtgcatcgcgggcacgacgagcgc
ctcgaccgtgtggtcgccctgaagatcatgcatccccacctcgctgcggacgaggacttc
cggcgtcggttcggccgggaggcacgctccgcggcacggctcgcgcaccgcaacgtcgtg
ggagtcttcgaccagggggaggacgaggaccgcatctatctcgccatggagctcgtcgag
ggcgagacgctgcgagcacggctggtcgagcagggccgcctgagcatccgcgagaccctc
caggtgaccgagcaggtgctcgaggccctggtggccgcgcacgctgcaggcatcgtccac
cgtgacatcaagcccgagaacatcctgctggaccccgacgacgtggtgaaggtcgccgac
ttcggtctcgcccgggcgatcggggcgagcaactcctcggcgagtgcgaccctgctcggc
accgtcgcctacatcagccctgaggtcgtcacccgcgggcacagcgacgaacgcagcgat
ctctactcgctcggcgtggtgctcttcgagatgctcaccggccgtcagccgttcgtcggc
gagcagcccgtccacatcgcgttccagcatgtccacgaagacatcccggcaccctcgaca
cgggtgaccgggctgccgcgggagctcgattccctggtcacgtgggccgcttcccgggtc
gtcgagcagcgccccgcgaccgccgccgagctgctggccgccgtgcgcgagctcaccgac
tccctgccgggaccggtcctcgaccggcggcccgtcccccgcgaggacggcgacaccggg
gacgtgccgcgaccgacctccccgctcgaggacgtcgtggccgagctgcacggcgggccg
cgcgccttccccgccggcctcctccccggcaccggggacgccccgtcctcggcgctgctg
ccctccgccggcggggagtccctcgccacgcagacgggggacgacgcaccgcagggcacg
gccgaggcggagaccgccggggcgccgaccggacccgacgacgaggaccggggcgaggac
gtggctcgagccgacgacgcggcccggaccgacgccgcggacgggggggagggcacgggc
gaggaggatgccggtcggcgcaccgtcgtgatgcgggccccgaagggacgacgcggccgc
cacctcccgccagggaccaggcaccgctctcgcccggtcgccgtgctcgccgcgctcagc
ctgctggccgccctgttcaccggcgcctgggccggcggcgactggtatctcaacaccggc
cccggggcggaccgcaccatcccggtgctggccggcaccgagctgagcgacgccgaggcc
gtgctcgccgcctccgatctgggtgtgaccacacggcagaccttcgacgagacggtcccc
gccgggcatgtcatcgcggccgatcccggggcggggaccacggtcaagaaggggacgaac
atcgaggtggtggtctccaagggcgtcgagaccttcccggtccccgatctggtcggcgcc
gagctggactcggccgcccaggaggtcgaggagctgggactggtgctcgtcgaggaggac
cccgagtactccgagaccgtcccggccggagaggtcatctcccagtcccaggaggccgag
gcgctgccggcagggggcgaggtgcacgtggtcgcctcccagggtccgcgaccgatcacc
atcgacgaccagaccggtaagagcggcgaagccgcccgcagcgccctggaatcggccggg
ttcgccgtggcggcctcctcggcccactcggcgaacgtccccgccggggcggtcatctcc
cagtccccctcgtccggcacgggccaccgcggcgacaccgtcaccctggtgacctccctc
ggccccgagatggtgacggtcccggacgtcttcaggcagtcggaggccgaggcgaagaag
accctcgaagccgccggtttcgacgtgaccgtgcggcacgaccggggcgagccggtgttc
gggctggtctacgagcagtccgccgcggccgggaccgaggtggccaagggctccgcgatc
acgatcacggtgttctga

DBGET integrated database retrieval system