KEGG   Brachybacterium sp. P6-10-X1: BH708_03340Help
Entry
BH708_03340       CDS       T04713                                 

Definition
(GenBank) sulfurtransferase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
brx  Brachybacterium sp. P6-10-X1
Pathway
brx00040  Pentose and glucuronate interconversions
brx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BH708_03340
Enzymes [BR:brx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BH708_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: APX31916
UniProt: A0A1P8NC60
LinkDB All DBs
Position
756234..757265
Genome map
AA seq 343 aa AA seqDB search
MRALVLQEKNRMAIEEVEPVGSPGPGQVRVAMHTVGICASDVHYWTDGKIGPFVVEEPMI
LGHEGAGTVVEVGEGVSDLSPGDRVAMEPGVPDPTSRAVKEGNYNVDPGVRFWATPPVDG
CLTDEVIHPAAYTYKLPESLSFAEGALIEPFSVGMFAATKAGIKPGDVAAVVGSGTIGIM
TALAARAGGASTVYISDVLPEKLALLDGLEGIVPVDATKEDLGERVRTETGGWGPQVVFE
ATGAAPAYKSLWSMPAPGGRIVLVGMPVEPVPFDIATAQSRGVSLETVFRYANVYQKAID
LAATDAIDLSRFVSETFTFDNSVQAFERFLEGRPTDVKLQITL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcactggtgctgcaggagaagaaccgaatggccatcgaggaggtcgagcccgtc
ggctcccccggccccggtcaggttcgcgtcgccatgcacaccgtggggatctgcgcctcc
gacgtccactactggaccgacgggaagatcggcccgttcgtcgtcgaggagccgatgatc
cttgggcacgagggtgccgggacggtcgtcgaggtcggtgagggcgtctccgacctctcc
cccggtgaccgcgtcgccatggagcccggcgtcccggaccccacctcccgggccgtgaag
gagggcaactacaacgtcgaccccggtgtgcggttctgggccaccccgcccgtcgacggc
tgcctgaccgacgaggtcatccaccccgccgcgtacacctacaagctccccgagagcctc
agcttcgccgaaggcgcgctcatcgagcccttctccgtgggcatgttcgccgccaccaag
gccgggatcaagcctggtgacgtcgccgccgtcgtgggctccggcaccatcggcatcatg
accgctctcgcggcccgcgccggaggcgccagcaccgtctacatcagcgacgtgctcccg
gagaagctcgccctgctcgacgggctcgagggcatcgtgcccgtcgacgccacgaaggag
gacctgggcgagcgcgtccgcaccgagaccggcggctggggcccgcaggtggtcttcgag
gccaccggtgccgcccccgcgtacaagagcctctggtccatgcccgcccccggcggccgg
atcgtcctggtcggcatgcccgtggagccggtgcccttcgatatcgccaccgcgcagagc
cgcggcgtctccctggagacggtcttccggtacgcgaacgtctaccagaaggccatcgac
ctcgccgccaccgacgccatcgacctcagccgcttcgtctcggagaccttcacattcgac
aattccgtgcaggccttcgagcgcttcctcgaaggtcgcccgacggacgtgaagttgcag
atcacgctctga

DBGET integrated database retrieval system