KEGG   Brachybacterium sp. P6-10-X1: BH708_12025Help
Entry
BH708_12025       CDS       T04713                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
brx  Brachybacterium sp. P6-10-X1
Pathway
brx00564  Glycerophospholipid metabolism
brx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:brx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BH708_12025
Enzymes [BR:brx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BH708_12025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA NAD_binding_8 AlaDh_PNT_C 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: APX33317
UniProt: A0A1P8NG89
LinkDB All DBs
Position
complement(2712914..2714650)
Genome map
AA seq 578 aa AA seqDB search
MSDQNRSALTPGARTEHLARLRAATAENPLDVLVIGGGVNGAGAAFDAATRGLSVGLVET
RDWAAGTSSRSSKLMHGGLRYLQMLDFKLVAEALRERDLLLEHTAPHLVKPVKFVFPFFK
KVVDRAFIGSGVMLYDAMQSIGRKRAVPFHRHLLHDKMMDVFPALDGDKAVGALEYYDAQ
MDDARFVMMLVRSAAQHDASVANYTSVVDYLHEGGRVSGARVRDEETGEEFEVHARDTLL
AGGVWTEDQQDLAGADAGLKVLASKGIHVTIARDRIPAVPETGIITQTEKSVLFIIPWDE
YWVIGTTDTAWTEDPADVGATSEDIDYVLEHANAVLADDLSREDVIGVYSGLRPLVQPVQ
KGGGSAKVSREHTVMQVEPGLSAIAGGKFTTYRVMAEDIVDFAIKEHQPGRPSLTRSVPV
IGAQGYETLVRDKQKIARRYDLDSVRIDRLLFRYGALLTDVLALVDEDPSLGTPLEHAPR
YLRAEALYAVRAEGARHLADILERRTRLDYETRDRGVDAAAEIAALVGPELGWDESTQAQ
EVATYREYIAARLEGEQAGTDAETAARIGAVPEVPPRR
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgatcagaaccggtccgccctcacccccggggcccggacggagcacctcgcccgc
ctgcgcgccgccactgccgagaaccccctggacgtcctcgtcatcggcggaggcgtcaac
ggcgccggcgccgcgttcgacgccgccacccgaggactgtccgtcggcctcgtcgagacc
cgcgactgggccgccgggacctcgtcgcgctcctccaagctcatgcacggcggcctgcgc
tacctgcagatgctggacttcaagctcgtcgccgaggccctgcgcgagcgcgacctgctg
ctcgagcacaccgctccgcacctggtcaagcccgtcaagttcgtcttccccttcttcaag
aaggtggtcgaccgcgcgttcatcggctccggcgtgatgctctacgacgcgatgcagtcc
atcggccgcaagcgcgccgtccccttccaccgccacctgctgcacgacaagatgatggac
gtcttcccggcgctcgacggcgacaaggccgtcggcgcgctggagtactacgacgcgcag
atggacgacgcccgcttcgtgatgatgctggtgcgctcggccgcgcagcacgacgcctcc
gtcgccaactacaccagcgtcgtcgactacctccacgagggcgggcgcgtcagcggcgcc
cgggtgcgggacgaggagaccggcgaggagttcgaggtccacgcccgcgacaccctcctg
gccggcggcgtctggaccgaggatcagcaggacctcgccggggccgacgccggcctgaag
gtgctcgcttccaagggcatccacgtcaccatcgcccgggaccgcatccccgccgtgccc
gagaccggcatcatcacccagaccgagaagtcggtcctgttcatcatcccctgggacgag
tactgggtcatcggcaccaccgacaccgcctggaccgaggacccggccgacgtcggcgcg
acctccgaggacatcgactacgtgctcgagcacgccaacgcggtgctggccgacgacctc
tcgcgcgaggacgtcatcggcgtctactccggcctgcgccccctggtccagccggtgcag
aagggcggcggctcggcgaaggtctcccgcgagcacacggtcatgcaggtcgagccgggc
ctgtccgccatcgccggcggcaagttcaccacctaccgggtgatggccgaggacatcgtc
gacttcgcgatcaaggagcaccagcccgggcggcccagcctgacccgctccgtgccggtg
atcggcgcccagggctacgagaccctggtgcgcgacaagcagaagatcgcccgacggtac
gacctcgactcggtgcgcatcgaccgcctgctgttccgctacggcgcactgctgaccgac
gtgctcgccctggtcgacgaggacccctcgctcggcaccccgctcgagcacgccccgcgc
tacctgcgggccgaagcgctgtacgccgtgcgcgccgagggggcgcgccacctggccgac
atcctcgagcgtcgcacccggctggactacgagacccgcgaccgcggcgtcgacgccgcc
gcggagatcgcggccctcgtcggccccgagctgggctgggacgagagcacccaggcgcag
gaggtcgcgacgtaccgcgagtacatcgccgcccgcctcgagggcgagcaggccgggacc
gacgccgagaccgcggcacgcatcggtgccgtccccgaggtgccgccgaggcgctga

DBGET integrated database retrieval system