KEGG   Brachybacterium sp. P6-10-X1: BH708_13630Help
Entry
BH708_13630       CDS       T04713                                 

Definition
(GenBank) D-erythrulose kinase
  KO
K20901  L-erythrulose 1-kinase [EC:2.7.1.209]
Organism
brx  Brachybacterium sp. P6-10-X1
Brite
KEGG Orthology (KO) [BR:brx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BH708_13630
Enzymes [BR:brx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.209  L-erythrulose 1-kinase
     BH708_13630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-ProteinID: APX33581
UniProt: A0A1P8NH26
LinkDB All DBs
Position
complement(3044820..3046535)
Genome map
AA seq 571 aa AA seqDB search
MTYLLNDPADFATDAVRGLALSHPDHVAVVHGGVVRATETPAGRPALVIGGGSGHYPAFA
GWVGPGMGHGAPCGNVFASPSASQVHSVARNAENGGGVILGFGNYAGDVLHFGAAAEKLR
AEGIDVRIVKVSDDIASNSPENHRDRRGIAGDLPVFKIAGAAIEAGADLEEAERIAWAAN
DATRSFGVAVDGCTLPGADEPLFHVAEGQMGVGLGIHGEPGVRDEPLGSADEIATLLVEG
ILAEQPARTEGGYQGRAAVILNGLGTVKYEELFIVYAKVGELLEAAGITPVRPEVGEFVT
SLDMAGLSLTLVFLDEELEAHWLAPVDTPAYHRGAMPDVERPLRTSFWEPGADRTPASTD
ESREVAATIAGVLDLFEAVCAREEAELGRIDAIAGDGDHGQGMAYGSRGAAAAARAALED
GAGARTVLVRAGEAWAESAGGTSGALWGGALTAAGGVFTDDDGCSPRTIVEALDAGIDAV
QRLGGARVGDKTMIDAAVPFRAALADAFTGENAAPAIRSAASSARRAADATADITAVLGR
ARVLGDRSLGAPDPGAISFSILMTELGAHLS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacttacctgctgaacgacccggccgacttcgcgaccgacgcagtccgcggcctggcc
ctgtcccatcccgatcatgtggccgtcgtgcacggcggcgtggtgcgggccaccgagacc
ccggccggccgaccggccctggtgatcggcggcggctccggccactaccccgccttcgcc
ggctgggtgggcccgggcatgggccacggagccccctgcggcaacgtgttcgcctccccg
tcggcctcccaggtccactcggtggcgcgcaacgccgagaacggcggcggcgtgatcctc
ggcttcggcaactacgccggcgacgtcctgcatttcggggcggccgccgagaagctgcgc
gccgagggcatcgacgtgcggatcgtgaaggtcagcgacgacatcgcctccaactccccc
gagaaccaccgcgaccgccgcggcatcgccggtgatctgccggtgttcaagatcgccgga
gccgcgatcgaggccggcgcggacctcgaggaggccgagcggatcgcctgggcggcgaac
gacgccacccgctccttcggcgtcgccgtcgacggctgcaccctgcccggtgcggacgag
ccgctgttccatgtggccgagggccagatgggcgtgggcctgggcatccacggcgagccc
ggggtgcgcgacgagcccctcggttcggccgacgagatcgcgacgctgctggtcgagggc
atcctcgccgagcagccggctcggacggagggcggttatcagggtcgtgccgcggtgatc
ctcaacggtctgggcacggtgaagtacgaggagctgttcatcgtctacgcgaaggtcggc
gagctgctcgaggccgccggcatcaccccggtgcgcccggaggtcggcgagttcgtcacc
agcttggacatggccgggctctccctgaccctcgtgttcctcgacgaggagctcgaggct
cactggctggctccggtcgacacccccgcctaccaccgcggcgcgatgcccgacgtcgag
cgcccgctgcgcacgtccttctgggagcccggggccgaccggacccccgcctccacggac
gagtcccgcgaggtcgcggcgacgatcgccggtgtgctcgacctgttcgaggcggtctgc
gcccgtgaggaggccgaactgggccgcatcgacgcgatcgcgggcgacggcgaccacggt
cagggcatggcctacgggtcgcgaggcgccgcggcggcggcgcgcgccgctctcgaggac
ggggccggggcgcgcaccgtcctggtccgcgccggcgaggcctgggcggagtcggccggg
ggcacctccggcgcgctgtggggcggagcgctgacggccgcgggcggcgtcttcaccgac
gacgacggctgttcgccgcgcacgatcgtcgaggcgctcgatgccggcatcgacgcggtc
cagcgcctgggcggggcccgggtgggcgacaagaccatgatcgacgccgccgttcccttc
cgtgccgccctcgccgacgccttcaccggcgagaacgccgccccggcgatccggtcggcg
gcgagctccgcgcggcgggccgccgacgccaccgccgacatcaccgcggtcctcggccgt
gcccgggtcctcggtgaccgatcgctgggcgcccccgaccccggcgcgatctcgttctcg
atcctcatgaccgagctcggcgcgcatctctcctga

DBGET integrated database retrieval system