KEGG   Brachybacterium sp. P6-10-X1: BH708_17365Help
Entry
BH708_17365       CDS       T04713                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
brx  Brachybacterium sp. P6-10-X1
Pathway
brx03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:brx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BH708_17365
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:brx03400]
    BH708_17365
Enzymes [BR:brx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BH708_17365
DNA repair and recombination proteins [BR:brx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BH708_17365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: APX34181
UniProt: A0A1P8NIW1
LinkDB All DBs
Position
3935466..3938039
Genome map
AA seq 857 aa AA seqDB search
MATAEQKVEIDGHTLKLSNLEKVFYPSTGTTKGDVIDYYRRIAPVMIPQATRRPATRKRW
VDGVGTARKPGKVFFRKDLEDHAPDWVPRSDIEHEDGTSTYPLVDETAVLVWLAQLAALE
IHTPQWRFDDEGGSRNPDRLVLDLDPGDGADLADCARVAQWCREILADMGLTSYPVTSGS
KGVHLYAPLDGASTADEVDEVAHQLARALEQDHPDQVVSDMKKSLRAGKVLVDWSQNNGH
KTTVCPYSLRGRLRPTVAAPRTWEEIEDPDLAHLEVDEVLERVEDGQDPIAPLGGEPGGA
PWRSGASGRSGGSGSGSQDEDTPSAERAPSTEQARDRLEVYRSKRDPDRTPEPVPESGAG
AEAAQDALDAAVPMFVIQEHHASSLHWDVRLENDGVLVSWAVPKGPPLEVDVNRLAVRTE
DHPLEYGTFEGTIPRDEYGGGDVSIWDTGTVEIEKWREGEEVIAVCHGRENGGLGGVPRR
YAFLHTGGMGGTQKTAAAKEKAASNWLLHLMKDQPEAVGAESQAATSADTAMGEPITPML
ATLGSRDDIRDQDEWAFEMKWDGVRVIATIAGGAVRLTSRGGKDLTATFPELAGLGEAID
PDVLAAGETVLDGEIVALDGKDRPSFSRLQQRLGLTRDRDVERARKDVTAQVMLFDLLVR
GGDSLLRTPYRQRREALFETVSANEHVHLPHADHGDVDHAIDLSRHLQLEGVMAKKEQST
YRPGKRARTWIKIKNARHQEVVVIGWRRGKGERSGTLGSLLVAVPDEDGTLRYAGRVGTG
FSEQDLEDIARTLRSRSRKTPPVDDVPRADARDAEWVRADLVGEVQHTERTDDGRLRHPV
WRGWRRDKTADEVRWED
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctgagcagaaggtcgagatcgacgggcacacgctgaagctctcgaacctc
gagaaggtcttctacccctccacgggcaccaccaagggcgatgtgatcgactactaccgc
cgcatcgccccggtgatgatcccccaggccacccggcgcccggcgacccggaagcgctgg
gtcgacggagtgggcacggcgaggaagcccgggaaggtgttcttccgcaaggatctcgag
gaccacgccccggactgggtgccgcggtcggacatcgagcacgaggacggcacctcgacg
taccccctggtcgacgagacggcggtgctggtctggctcgcccagctcgccgccctggag
atccataccccgcaatggcggttcgacgacgagggcgggagcaggaacccggaccgcttg
gtgctcgacctcgacccgggcgacggcgccgatctggcggactgcgcccgcgtcgcgcag
tggtgccgggagatcctcgcggacatgggtcttacgtcctacccggtgacgtccggctcg
aagggggtccacctgtacgccccgctggacggggccagcaccgccgacgaggtcgacgag
gtcgcccaccagctggcgcgcgccctcgagcaggatcatcccgaccaggtggtcagcgac
atgaagaagtcgctgcgcgccggcaaggtcctggtggactggtcgcagaacaacggtcac
aagaccaccgtgtgtccctactccctgcgcggccggctccgcccgaccgtcgccgccccc
cgcacctgggaggagatcgaagaccccgatctggcccatctcgaggtcgacgaggtgctg
gagagggtggaggacgggcaggacccgatcgctccgctcggaggggagccgggcggtgcg
ccatggcgctccggcgcctcgggccgctccggcggctcgggctccgggagccaggacgag
gacaccccgtcggcagagcgcgctccctcgaccgagcaggcccgcgaccggctcgaggtc
taccgctccaaacgtgatcccgacaggaccccggagccggttcccgagtcgggagccggc
gccgaggccgcgcaggacgccctcgatgccgcggtgccgatgttcgtcatccaggagcac
cacgcctcgtccctgcactgggatgtccgcctcgagaacgacggggtgctggtctcctgg
gcggttcccaagggaccgccgctcgaggtcgacgtgaaccgcctcgccgtccggaccgag
gaccatcctctcgagtacggcaccttcgagggcaccatcccccgcgacgagtacggcggc
ggcgacgtgagcatctgggacaccgggacggtcgagatcgagaagtggcgcgagggcgag
gaggtcatcgccgtctgccacggccgcgagaacggggggctgggcggggtgccgcgccgc
tacgccttcctccacaccggcggcatgggcgggacgcagaagaccgcggcggcgaaggag
aaggccgcctcgaactggctgctgcacctcatgaaggaccagcccgaggccgtgggcgcg
gagtcgcaagccgcgacctcggccgacaccgccatgggcgagccgatcacccccatgctc
gccaccctcggcagccgggacgacatccgcgaccaggatgaatgggccttcgagatgaag
tgggacggcgtgcgcgtgatcgccaccatcgcagggggcgccgtccgcctgaccagccgt
ggcggcaaggacctcaccgccaccttccccgagctcgccgggctgggcgaggcgatcgat
ccggacgtcctcgccgccggcgagacggtgctggacggggagatcgtggcgctggacggc
aaggaccggccctccttctcccgcctccagcagcgcctcgggctcacccgcgaccgggac
gtcgaacgcgcccggaaggacgtcacggcacaggtgatgctcttcgacctgctggtgcgc
ggcggcgactccctgctgcgcaccccgtaccgacagcgacgcgaggcgctgttcgagacc
gtgagcgccaacgagcacgtccacctgccgcatgccgatcatggcgatgtcgaccatgcg
atcgacctctcgcggcacctgcagctcgaaggggtgatggccaagaaggagcagagcacc
taccggcccgggaagcgcgcccgcacctggatcaagatcaagaacgcgcgccaccaggag
gtcgtcgtcatcggatggcgtcgcggcaaaggcgagcgctccggcaccctcggctccctg
ctggtggccgtgccggacgaggacgggacgctgcgctacgcgggtcgcgtcggcaccggc
ttcagcgagcaggacctcgaggacatcgcccgcacgctgcgctcccgatcccgcaagacc
ccgccggtggacgacgtcccccgcgcggacgcccgcgacgccgaatgggtccgcgccgat
ctcgtcggcgaggtccagcacaccgaacggaccgacgacggccgcctgcgccaccccgtc
tggcgcggctggcgtcgggacaagaccgccgacgaggtgcgctgggaggactga

DBGET integrated database retrieval system