KEGG   Brachybacterium sp. P6-10-X1: BH708_17475Help
Entry
BH708_17475       CDS       T04713                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brx  Brachybacterium sp. P6-10-X1
Pathway
brx00620  Pyruvate metabolism
brx00680  Methane metabolism
brx01100  Metabolic pathways
brx01120  Microbial metabolism in diverse environments
brx01200  Carbon metabolism
Module
brx_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:brx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BH708_17475
  09102 Energy metabolism
   00680 Methane metabolism
    BH708_17475
Enzymes [BR:brx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BH708_17475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 SF3a60_bindingd
Motif
Other DBs
NCBI-ProteinID: APX34198
UniProt: A0A1P8NIP2
LinkDB All DBs
Position
3960118..3962946
Genome map
AA seq 942 aa AA seqDB search
MPETDAIAVPTLTSEFPVVGDDPHIDAPLRATVRRLSTLLGRTLADQHGQELLDLVEQVR
TLTKDAKSSESEGEARDVQDRLAELPIEQATELTRAFAQYFLLANAAEQVYRVRGLNDRP
ASQSWVPRTVADVHEEVGPTGLQEAVDSLDVRLIFTAHPTEASRRAVLTKLRKISDILEQ
DTEEGTAERRRQDHALSELIESLWQTDELRRQRPTPQDEARNVLYYLRQLYMQTMPGFLD
DLREELRGHGADLSERQVPLRFGSWIGGDRDGNPFVTAEVTREVLQLQAETAVDLAIDVI
SELIADLSISSALTGEDEELRASIAADLEFESEVDEVQQRLYEQEPYRLKLGTMRAKLTA
TRERILSGEPHVHGKDYRDGDELQQDFSVLRSALGRHGGKRAADGAIAIAQQVLAGSGLN
LATLDVREHSEKHHEVLARVFDRVGELDRPYAELSRAERTTVLGAELASRRPLVGTALSS
DETILDDATRTTYRVLDEIRDAHRKYGTSSIETYIVSMTHGADDILAVALLAREAGLVTL
PGGEGNRADISFAPLLEEVSELRHAGEILDELLSDPSYRKIVRLRGDLQEVMLGYSDGNK
DAGVMTSQWEIHQAQRRLRDVAARHGVTLRLFHGRGGSVGRGGGPTYDAILAQPYGVLEG
EIKFTEQGEVISDKYTLPTLARENLDLSLAAVLEGSALHTTPRSTEEQLGRWGEVMQTVS
DASFTRYRTLADDPDLPEYFVTSTPVEQLGDLNIGSRPSKRATSDKGLDGLRAIPWVFGW
TQSRQIVPGWFGAGSGLKAAREAGLEPDLHEMYRSWHFFRTVISNVEMTLAKTDMQIAAH
YVHSLVPERLWPLFDRIKAEYELSVAELERLTGVLELLDNQPVLKRTLAVRDRYLDPISY
MQVAMLQRARAATARGEELSPELQRALLTTINGVAAGLKNTG
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaaaccgacgccattgccgtcccgaccctgacgagcgagttccccgtcgtcggc
gatgatccccatatcgatgcgccgctgcgtgcgaccgtccgccgcctgtcgaccctgctg
ggtcgcaccctcgccgaccagcacggccaggagctgctggacctcgtcgagcaggtccgc
acgctgaccaaggacgcgaagtcctcggagtccgagggcgaggcgcgtgacgtccaggac
cgactggcggagctgccgatcgagcaggccaccgagctgacccgtgccttcgcccagtac
ttcctgctggcgaacgccgcggagcaggtgtaccgggtgcgtgggctgaatgatcgcccg
gcctctcagtcgtgggtgccgcgcaccgtcgcggacgtccacgaggaggtcggccccacc
ggtctgcaggaggctgtcgactcgctcgacgtgcgcctgatcttcacggcccatcccacc
gaggcgtcccgccgggcggtcctgaccaagctgcgcaagatctccgacatcctggagcag
gacacggaggagggcaccgccgagcggcgccgccaggaccatgcgctctccgagctcatc
gagtcgctgtggcagaccgacgagctgcgccgccagcggcccaccccgcaggacgaggcc
cgcaacgtcctgtactacctccgtcagctgtacatgcagaccatgccgggcttcctcgac
gatctgcgcgaggagctgcgcggccatggggcggacctgtccgagcgccaggtcccgctg
cgcttcggctcctggatcggcggtgaccgtgacggcaaccccttcgtcaccgcggaggtc
acgcgcgaggtcctgcagctgcaggcggagaccgccgtggatctcgcgatcgacgtcatc
tcggagctgatcgcggacctgtcgatctccagcgcgctgaccggtgaggacgaggagctg
cgcgcgagcatcgcggccgatctcgagttcgagtccgaggtcgacgaggtccagcagagg
ctgtacgagcaggagccctaccggctcaagctcgggaccatgcgggcgaagctcacggcc
acccgcgaacggatcctcagcggggaaccgcacgtgcacggcaaggactaccgcgacggc
gacgagctgcagcaggacttctcggtgctgcggtccgcgctgggtcgtcatggcggcaag
cgcgccgccgacggggcgatcgcgatcgcgcagcaggtgctggccggctccggcctgaac
ctggcgaccctcgacgtgcgcgagcactccgagaagcaccacgaggtgctcgcccgggtc
ttcgaccgcgtcggggagctggatcgcccctatgcggagctcagccgcgccgagcgcacc
acggtgctgggggccgagctcgccagccgccgcccgctggtcggcacggcgctcagctcg
gacgagacgatcctcgacgacgccacccgcaccacctaccgggtgctcgacgagatccgc
gacgcccatcgcaagtacggcacctcctccatcgagacctacatcgtctcgatgacccac
ggggccgacgacatcctcgcggtcgccctgctggcccgtgaggccggtctggtcacgctg
cccggcggcgaggggaaccgcgccgacatcagcttcgccccgctgctcgaggaggtctcc
gagctgcgtcacgccggcgagatcctcgacgagctgctcagcgacccctcctatcgcaag
atcgtccgcctgcgcggtgacctgcaggaggtcatgctcggctactccgacggcaacaag
gacgccggcgtgatgaccagccagtgggagatccaccaggcccagcggcgtctgcgtgac
gtcgcggcgcgccacggggtgacgctgcgcctgttccacggtcgcggcgggtccgtgggc
cgcggcggcgggccgacctacgacgcgatcctcgcccagccgtacggcgtgctcgagggc
gagatcaagttcaccgagcagggcgaggtcatctccgacaagtacaccctgcccacgctg
gcccgggagaacctcgacctgtcgctggcggcggtgctcgagggctctgctctgcacacc
acgccgcgctccaccgaggagcagctgggacgctggggcgaggtcatgcagaccgtctcc
gacgcctccttcacccggtaccgcacgctggccgacgacccggacctgcccgagtacttc
gtcacctccaccccggtggagcagctcggggacctgaacatcggctcgcgcccctccaag
cgcgccacctccgacaagggcctggacggcctgcgggcgatcccgtgggtgttcggctgg
acccagtcgcggcagatcgtgccgggctggttcggcgcgggctccgggctgaaggccgcc
cgtgaggccgggctcgagccggacctgcacgagatgtaccgcagctggcacttcttccgc
accgtgatcagcaacgtggagatgacgctggcgaagacggacatgcagatcgccgcgcac
tacgtgcactcgctggtgccggagcggctgtggccgctgttcgaccggatcaaggcggag
tacgagctgtccgtcgcggagctcgagcgcctcaccggggtgctggagctgctggacaac
cagccggtgctgaagcggaccctcgccgtgcgcgaccgctacctggatccgatctcctac
atgcaggtggcgatgctgcagcgcgcccgggccgcgacggctcgcggcgaggagctctcc
ccggagctgcagcgcgcgctgctgaccacgatcaacggtgtggcggccggtctgaagaac
accggctga

DBGET integrated database retrieval system