KEGG   Brachybacterium sp. P6-10-X1: BH708_17940Help
Entry
BH708_17940       CDS       T04713                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
brx  Brachybacterium sp. P6-10-X1
Pathway
brx00511  Other glycan degradation
brx00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:brx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    BH708_17940
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BH708_17940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:brx02042]
    BH708_17940
Enzymes [BR:brx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BH708_17940
Bacterial toxins [BR:brx02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BH708_17940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR BNR_3
Motif
Other DBs
NCBI-ProteinID: APX34274
UniProt: A0A1P8NIX5
LinkDB All DBs
Position
complement(4071370..4072581)
Genome map
AA seq 403 aa AA seqDB search
MENHLTRRGLLGTAAAVTALGAGTAAGALPPPTENGRRHGTYEDQALAWSGYQGVDNFRI
PALAVAPNGDLLAAFDKRPGFGDAPAPNSVWQRRSRDGGHTWGEPTVVRQGFESDVPGEK
LGYSDPSYVVDREAGLVYCFCVFSKDTGVWNGEYGNDDEDRGVLSANLSVSRDSGETWEH
RSVTEIVKPTDCRATFASSGAGIQLRYGKHAGRLVQQYAGFFRGAGDGEIVQAYSVYSDD
HGQSWTMGTPVGTEMDENKVVELSDGTLMMNSREHVRTGHRWVALSHDGGETWQDLHRDL
SLRDPGNNAHITRAYPDAPQSSARARVLLFSHADHVPDDRVNGTIEISTDDGATWERKRV
FDPGVCQYSVIIAIGRDQYGLLYEAAGSTITFARLDMDWILSR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccacctgacccgacgcggcctgctcggcacggccgccgccgtgaccgctctc
ggtgccggcaccgccgccggagcgctgcccccgccgacggagaacggccgccgccacggc
acctacgaggaccaggcgctggcctggtccgggtaccagggcgtggacaacttccgcatc
cccgccctggccgtcgcccccaacggcgacctgctggccgccttcgacaaacgtcccggc
ttcggggacgcgccggcgccgaactccgtgtggcagcgccgctcccgcgacggcgggcac
acctggggcgagccgacggtggtgcgccagggcttcgagtccgacgtgcccggcgagaag
ctcggctactccgatccgtcctacgtggtcgaccgcgaggccggtctggtctactgcttc
tgcgtgttctcgaaggacaccggggtgtggaacggcgagtacggcaacgacgacgaggac
cgcggcgtgctcagcgcgaacctgtccgtcagccgcgactcgggcgagacctgggagcac
cgctcggtcaccgagatcgtcaagccgacggactgccgggccaccttcgcctcctccggc
gccggcatccagctgcgctacgggaagcacgcgggccgcctggtccagcagtacgcgggg
ttcttccgcggcgccggcgacggcgagatcgtccaggcctactccgtctactccgacgac
cacgggcagagctggaccatgggcaccccggtcggcaccgagatggacgagaacaaggtc
gtcgagctctccgacggcacgctgatgatgaactcccgcgagcatgtgcgcaccgggcac
cggtgggtggcgctcagccacgacggcggcgagacctggcaggacctgcaccgcgacctg
tccctgcgggacccgggcaacaacgcgcacatcacccgggcctacccggatgcgccgcag
agctccgcgagggcccgcgtcctgctgttctcccatgcggaccacgtgcccgacgaccgc
gtgaacggcacgatcgagatctcgaccgatgacggcgccacctgggagcgcaagcgggtc
ttcgatcccggcgtctgccagtactccgtcatcatcgcgatcggacgcgatcaatacgga
ctgctgtacgaggcggcgggatcgaccatcaccttcgcccgcctcgacatggattggatc
ctctcacggtga

DBGET integrated database retrieval system