KEGG   Brachybacterium sp. VM2412: CFK38_00695Help
Entry
CFK38_00695       CDS       T05108                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:brz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CFK38_00695
Enzymes [BR:brz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CFK38_00695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 Glyco_hydro_35 DUF4434 YacG Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ATG50202
UniProt: A0A291GJH6
LinkDB All DBs
Position
160612..162669
Genome map
AA seq 685 aa AA seqDB search
MTSDRFPSSRPDVRESTDARPPQTRPSWPLGLDGLAYGGDYNPEQWTRETWVEDVRLMRE
AGVNLVSIGMFSWASIEPRQGEFHWEWLDEIFELLHEAGIRIDLGTPTAAPPAWFFRAHP
ESRVVDRAGRSLGPGSRGMACPSSPAYRSAATGITRALAERYGDHPALALWHVHNEYGAP
VGESFSTFAQDAFRHWALRRHGSLEAVNSAWGTAFWGQSFGVPEEIHAPLPTPSVHNPSL
ALDWRRFSSEQILECFRAERDVLHELAPHIPVTTNFMAHTCRNIDLWKWADEVDVVSNDH
YLIASDDRNFVELALDADLARSIARGRPWMLMEHSTSGVNWQGRNVAKQPGEMARNSLSH
VGRGADAVMFFQWRASRKGAEKFHSAMLPHAGTNSRIWREVRELGTQLEGLAGIRGTRVR
ADVAILWDWESHWAQDLPWRPADDLSHRAQIQTWYERLWRDHLAADFAHPEDDLSGYRLV
LAPASYLLTDAAAAKLAAYVREGGNLVVGPFSGVVDAEDGVREGGLNASLAPVLGVEVHE
FCPLRKGDDARIVLGGHSVRARLWCEDLQLRGAEPIGSYADGPVSGGVAATQHTYGQGTA
WYLASDLDVVDLSVLFSEPYCAAGLAPRELPEDVELLERIGEDGTRHLIALNHTAEDQAL
PAGDHGTVSVPAHGVATSRRPRVGA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgatcgattcccctcctcccgtcccgacgtgcgggaatccaccgatgctcga
cccccgcagacccgtccctcatggccgctcggcctggatggcctcgcgtacggcggtgac
tacaaccccgagcagtggacccgcgagacctgggtcgaggacgtgcgcctgatgcgggag
gccggagtgaacctggtgagcatcgggatgttctcctgggcgagcatcgagccgcgccag
ggcgagttccactgggaatggctcgatgagatcttcgaactgctgcacgaggccgggatc
cggatcgacctgggcacccccaccgccgctcccccggcctggttcttccgcgcgcatccg
gaatcgcgcgtggtcgaccgagcgggccggtccctcgggcccgggtcgcggggcatggcc
tgtccgtcgtccccggcgtaccgttcggcggccaccggcatcacccgagcgctggccgag
cgctacggggaccatcccgcgctcgcgctctggcacgtccacaacgagtacggcgcgccc
gtcggagagagcttctcgaccttcgcgcaggatgcgttccgccactgggcgctgcggcgc
cacggctcgctcgaggcggtcaactccgcctgggggaccgccttctggggccagagcttc
ggcgtccccgaagagatccacgccccgctgcccaccccctcggtgcacaacccctcgctc
gcactggactggcgtcgcttcagctccgagcagatcctggagtgcttccgcgccgagcgc
gacgtcctgcacgagctcgcgccccatatcccggtgaccacgaatttcatggcgcacacc
tgccggaacatcgacctgtggaagtgggccgacgaggtcgacgtggtctccaacgaccac
tacctgatcgcctccgacgaccggaacttcgtcgagctcgccctcgatgccgacctcgcg
cgctccatcgcccggggccgtccgtggatgctcatggagcattccacctccggggtgaac
tggcagggtcgcaacgtcgccaagcagcccggggagatggcccgcaactccctgtcccat
gtgggccggggcgccgatgccgtgatgttcttccagtggcgagcctcccgcaagggcgcc
gagaagttccattcggcgatgcttccgcatgcgggcacgaactcccggatctggcgcgag
gtccgcgaactcggcacacagctggagggcctggcggggatccgcggcacgcgagtgcgg
gccgacgtcgcgatcctctgggactgggagtcccactgggcgcaggacctcccctggcga
cccgcggacgacctgagccaccgcgcccagatccagacctggtacgagcggctgtggcgc
gatcacctcgcagccgacttcgcgcacccggaggacgacctgagcgggtaccgcctggtg
ctcgcgccggcctcctacctcctcaccgatgccgcggcggcgaagctcgccgcgtacgtg
cgcgagggcgggaacctcgtcgtcggacccttctcaggcgtcgtcgatgcagaggacgga
gtgcgcgagggcgggctgaacgcctcgctggcaccggtgctcggtgtcgaggtgcacgaa
ttctgcccgctgagaaagggggacgacgcacggatcgtcctcggcgggcactccgtgcgt
gcgcgcctctggtgcgaggatctgcagctgcgcggggcggagccgatcggcagctacgcc
gatgggccggtgtccgggggcgtcgctgcgacgcagcacacatacggccagggcacggcc
tggtatctcgcctccgatctcgacgtcgtggacctctccgtcctgttcagcgagccgtac
tgcgccgcgggactcgcgccgagagagcttcccgaggatgtcgagctgctcgagcgcatc
ggggaggacggcacccgtcatctgatcgcgctcaaccacaccgctgaggaccaggcgctg
cccgctggggaccacggcaccgtgtcggtgccggcgcacggcgtcgcgacctcccgccgt
ccgcgagtcggggcatga

DBGET integrated database retrieval system