KEGG   Brachybacterium sp. VM2412: CFK38_08265Help
Entry
CFK38_08265       CDS       T05108                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz00020  Citrate cycle (TCA cycle)
brz00190  Oxidative phosphorylation
brz00650  Butanoate metabolism
brz01100  Metabolic pathways
brz01110  Biosynthesis of secondary metabolites
brz01120  Microbial metabolism in diverse environments
brz01130  Biosynthesis of antibiotics
brz01200  Carbon metabolism
Module
brz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
brz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
brz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:brz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFK38_08265
   00650 Butanoate metabolism
    CFK38_08265
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFK38_08265
Enzymes [BR:brz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFK38_08265
    1.3.5.4  fumarate reductase (quinol)
     CFK38_08265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_4 Fer4_18 Fer4_6 Fer4_2 Fer4_15 Fer4_21 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ATG51522
UniProt: A0A291GN92
LinkDB All DBs
Position
complement(1843260..1844021)
Genome map
AA seq 253 aa AA seqDB search
MTAVTEKPEAESGADEIPTFQVTLRISRFDPDSEKGARWEDFTVTMHGTDRVLDALHEIK
WHLDGSLTFRRSCAHGVCGSDAMRINGRNRLACKTLLKDLDINKPITIEPIKGLPVEKDL
IVDMEPFFDSYREVMPFLVAGGQEPSRERLQSAEQRERFDDTTKCILCAACTSSCPVFWT
DGQYFGPAAIVNAHRFIFDSRDDAGEQRLEILNSKEGVWRCRTTFNCTEACPRGIQVTKA
IAEVKQAVITGRV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgtcactgagaagcccgaggccgagtccggcgccgacgagatccccacgttc
caggtcacgctgcgcatctcgcgcttcgatcccgacagcgagaagggtgcccgctgggag
gacttcaccgtcacgatgcacggcacggaccgggtgctggacgccctccacgagatcaag
tggcacctggacggctcgctgaccttccgccgttcctgcgcccatggcgtatgcggttcc
gatgcgatgcggatcaacggccgcaaccgcctggcctgcaagacgctgctcaaggacctc
gacatcaacaagccgatcaccatcgagcccatcaagggcctgccggtggagaaggacctg
atcgtcgacatggagccgttcttcgactcctaccgcgaggtcatgcccttcctggtcgcc
gggggtcaggagcccagccgcgagcgtctgcagtccgccgagcagcgggagcgcttcgac
gacaccaccaagtgcatcctgtgcgccgcctgcacctcctcgtgcccggtgttctggacc
gatgggcagtacttcggcccggccgcgatcgtcaacgcgcaccgcttcatcttcgactcg
cgcgatgacgccggcgagcagcgcctggagatcctgaactccaaggagggcgtgtggcgc
tgccgcaccaccttcaactgcaccgaggcctgcccccgcgggatccaggtgaccaaggcg
atcgccgaggtgaagcaggccgtgatcaccggccgggtctga

DBGET integrated database retrieval system