KEGG   Brachybacterium sp. VM2412: CFK38_09720Help
Entry
CFK38_09720       CDS       T05108                                 

Definition
(GenBank) DNA-formamidopyrimidine glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:brz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CFK38_09720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:brz03400]
    CFK38_09720
Enzymes [BR:brz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     CFK38_09720
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     CFK38_09720
DNA repair and recombination proteins [BR:brz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CFK38_09720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS Zn_Tnp_IS91 Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ATG51767
UniProt: A0A291GNN3
LinkDB All DBs
Position
2166674..2167624
Genome map
AA seq 316 aa AA seqDB search
MPELPEVEVVRRGLAPRTVGRTVTDVELLDARIIRRQHGGIDRLRAGLVGSTLTAVVRRG
KFLWWRLADPDGAETGEALMGHLGMSGQLRIATADGATVTPGGPPAPSEGPAPDPQRHRR
LSLHLDDGTRVDLIDQRLFGGVWTSPLVEAADGALAGVGSPDALLPEGASHIARDLLDPA
VDLGAIARTLRARRSAVKALLLNQEIVSGIGNIYADEALWSARTRYDTPGTALSQRRALA
ILRAAREVMERALAVGGTSFDALYVNVDGRSGYFARSLNAYGREGEPCPRCGRLLRRVIY
QGRSSHFCPRCQRRTM
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgcccgaggtcgaggtcgtccggcgaggcctcgccccccgcaccgtgggc
cgcaccgtcacggacgtcgagctgctcgatgcccgcatcatccgccgccagcacgggggc
atcgaccggctgcgcgccgggctcgtgggctcgaccctcaccgccgtggtgcggaggggg
aagttcctgtggtggcgtctcgccgaccccgacggcgccgagaccggcgaggcgctgatg
gggcacctggggatgagcggccagctgcggatcgcgacggccgacggggcgaccgtcacg
cccggcggaccgcccgcaccctccgaggggcccgcccccgacccgcagcgccaccgccgg
ctctccctccacctcgacgacggcacgcgggtggacctcatcgaccagcggctcttcggc
ggtgtgtggaccagcccgctggtggaggcggccgacggcgcgctcgccggggtcggcagc
cccgatgcgctgctgcccgagggcgcctcccacatcgcccgcgacctgctggacccggcc
gttgacctgggggcgatcgcccggaccctgcgggcccggcgcagtgcggtcaaggccctg
ctgctgaatcaggagatcgtctccgggatcgggaacatctacgccgacgaggcgctgtgg
agcgcccgcacccgctacgacacccccggcaccgcgctcagccagcgccgggcgctcgcg
atcctccgcgccgcccgcgaggtgatggagcgggcactggcggtgggcggcaccagcttc
gacgcgctgtacgtgaacgtcgacgggcgcagcgggtacttcgcacggtcactgaacgcc
tacgggcgtgagggcgagccgtgcccgcggtgcggtagattgcttcgacgagtgatctac
cagggcaggagcagtcatttctgcccccggtgccagcgcaggacgatgtga

DBGET integrated database retrieval system