KEGG   Brachybacterium sp. VM2412: CFK38_10905Help
Entry
CFK38_10905       CDS       T05108                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz00340  Histidine metabolism
brz01100  Metabolic pathways
brz01110  Biosynthesis of secondary metabolites
brz01230  Biosynthesis of amino acids
Module
brz_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:brz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CFK38_10905
Enzymes [BR:brz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CFK38_10905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG DCX
Motif
Other DBs
NCBI-ProteinID: ATG51971
UniProt: A0A291GP10
LinkDB All DBs
Position
2416816..2417139
Genome map
AA seq 107 aa AA seqDB search
MLSGGRATARAPDPDAYPGGVKDFEALFAELTDKARTRPEGSGTVRELDGGVHQIGKKIV
EEAAEVWMACEYESKDDAAMEISQLLYHLQVMMIAKDISLEDVYRQL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
ctgctgtccggcgggcgggcgacggcgcgcgcgcccgacccggacgcgtaccctgggggc
gtgaaggatttcgaggcgctgttcgccgagctcaccgacaaggcccgcacccgacccgag
gggtcgggcaccgtccgcgaactcgacggcggtgtccatcagatcggcaagaagatcgtc
gaggaggccgccgaggtgtggatggcctgcgagtacgagtccaaggacgacgccgcgatg
gagatcagccagctgctctaccacctgcaggtgatgatgatcgccaaggacatctccctc
gaggacgtctaccgccagctctga

DBGET integrated database retrieval system