KEGG   Brachybacterium sp. VM2412: CFK38_11065Help
Entry
CFK38_11065       CDS       T05108                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz00040  Pentose and glucuronate interconversions
brz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:brz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CFK38_11065
Enzymes [BR:brz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     CFK38_11065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C TmoB HI0933_like
Motif
Other DBs
NCBI-ProteinID: ATG52001
UniProt: A0A291GP40
LinkDB All DBs
Position
complement(2451573..2452604)
Genome map
AA seq 343 aa AA seqDB search
MRALMLHEKNRMSIEEVEPAGAPGPGEVRIAMHTVGICASDVHYWTDGRIGPFVVRAPMI
LGHEGAGTVAEVGEGVSHLAVGDRVAMEPGVPDPRSRAVREGNYNVDPGVRFWATPPVHG
CLVDEVIHPAAFTYLLPDSLSFAEGALIEPFSVGMFAATKAGITPGDVVAVVGAGTIGIM
TALAARAGGASTVFISDVLPQKLALLDGLEGIVTVDATQEDLGERVRAETGGWGPQVVFE
ATGAVAAYAKLWELPAPGGRIVLVGMPVDPVPFDIATAQSRGISLETVFRYANVYQKAID
LAASDAVDLSRFVSETFSFDDSVGAFERFLEGRPTDVKIQITL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctgatgctgcacgagaagaaccggatgtcgatcgaggaggtcgagcccgcc
ggcgctcccggccccggtgaggtgcggatcgcgatgcacaccgtcggcatctgcgcctcg
gacgtgcactactggacagatggcaggatcggcccgttcgtggtgagagcgccgatgatc
ctcgggcacgagggtgccggcaccgtcgcagaggtcggtgagggcgtgagtcacctggcc
gtcggcgatcgtgtcgcgatggagcccggtgtccccgatccccgctcccgtgcggtgcgc
gagggcaactacaacgtggatcccggcgtgcggttctgggccaccccgccggtgcacggc
tgcctcgtcgacgaggtcatccatcccgccgccttcacgtatctgctccccgacagcctc
agcttcgccgagggggcgctgatcgagccgttctccgtcggcatgttcgcggcgacgaag
gccgggatcacgcccggcgatgtcgtggccgtcgtcggggccggcacgatcgggatcatg
accgcgctcgccgcgcgtgcgggcggcgccagcaccgtcttcatctccgacgtgctgccg
cagaagctggccctgctcgacgggctcgagggcatcgtcaccgtggacgccacccaggag
gacctgggcgagcgggtgcgcgcggagaccggcggctggggaccgcaggtggtgttcgag
gccaccggcgccgtcgccgcctacgcgaagctgtgggagctgcccgccccgggtggccgc
atcgtgctggtgggcatgccggtggatccggtgcccttcgacatcgccaccgcccagagc
cgcggcatctcgctggagacggtgttccggtacgcgaacgtgtaccagaaggcgatcgac
ctcgccgcgagcgacgccgtggacctctcccgcttcgtctcggagaccttctccttcgac
gactccgtcggcgccttcgagcgcttcctcgagggccgccccaccgatgtgaagatccag
atcacgctgtag

DBGET integrated database retrieval system