KEGG   Brachybacterium sp. VM2412: CFK38_11665Help
Entry
CFK38_11665       CDS       T05108                                 

Definition
(GenBank) lantibiotic ABC transporter permease
  KO
K10441  ribose transport system ATP-binding protein [EC:7.5.2.7]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:brz00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CFK38_11665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:brz02000]
    CFK38_11665
Enzymes [BR:brz01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.7  ABC-type D-ribose transporter
     CFK38_11665
Transporters [BR:brz02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    CFK38_11665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_30 AAA_22 AAA_29 AAA_16 AAA_14 AAA_15 SMC_N AAA_23 DUF87 RsgA_GTPase AAA_33 ABC_ATPase AAA_24 Zeta_toxin AAA_27 cobW MMR_HSR1 TrwB_AAD_bind ATP-synt_ab NACHT
Motif
Other DBs
NCBI-ProteinID: ATG52106
UniProt: A0A291GQ41
LinkDB All DBs
Position
complement(2586528..2588030)
Genome map
AA seq 500 aa AA seqDB search
MAPDSIVEVRNISKQFGGVHALRDVSMEVRRGEVHAIIGENGAGKSTLMKILAGAYKKDE
GTIVIDGELVDAQSPRDIINRGISVIYQEFMLAPDLTVAENIFIDDLQQSHLFINWSDLN
RRASEELQKLGFGHISPTTKVHNLSVAYQQIVEICKSLVKKSKLIIFDEPTAVLTHAETE
GLLDIIRKLNGSGVTIVYISHRLKELFAISDRISVLKDGGLVGTVDTSSISEEQLVTMMV
GREIEQLFPAREGPGLTREEQSELLRVEGLSVGDLVKDVNFTVRRGEIVGFSGLIGAGRT
ETMRAIFGVDKKTGGEIFWKGEKISPKNPRKSIRMGIGLLPEDRKGQGLVLEQPIRTNAT
LVSQRGNGFIGAKAERRKVTELLETVATRYGSMDDNVESLSGGNQQKVSLAKWLAVDTEL
IILDEPTRGVDVGAKVEMYGLINSLADSGVGVVLVSSEMIEIIGICDRALVMREGEVTGE
LNKEELTESNLIKLAMGVES
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcaccagacagtatcgttgaagtgcgtaacatttccaagcagttcggtggagtccat
gcgctgcgtgacgtctcgatggaagtcaggcgtggagaggtccacgccatcatcggtgag
aacggggctggaaaatcaacgctgatgaagatactggcgggcgcgtacaaaaaggacgag
ggtaccatcgtaatcgatggagagctcgtggacgcgcagtcgccgagagacatcatcaat
cgtggcatctcggtgatctatcaagaattcatgctcgcaccggatctgacggttgccgag
aacatcttcatcgacgatctccagcagtctcatctcttcatcaactggagtgacctgaat
cggcgagccagcgaagaactgcagaagctcggatttgggcacatcagccccacgaccaag
gtgcataacctcagcgtcgcctaccagcagatcgtagagatctgtaaatccctggtgaaa
aaatcgaagctcatcatcttcgatgagccaaccgctgtgctcacccacgccgagaccgag
gggctcctggatatcatccggaagctgaacggcagcggcgtcacgatcgtctacatctcg
caccgcctcaaagagctgttcgccatctctgaccgcatttcagtgctcaaagacggtggc
ctcgtcggtacggttgatacctcctcgatttcggaggagcaactcgtgacgatgatggta
ggccgcgagatcgagcagctcttcccggcgcgcgaagggcccggattgacccgggaagag
cagagcgaactgctgcgtgtcgaagggctgtccgtaggtgaccttgtcaaggatgtgaac
ttcacggtgcgccgcggcgagatcgttgggttcagtggtcttatcggcgcgggccgcacc
gagaccatgagagcgatcttcggcgtcgacaaaaagacaggtggggagatcttttggaag
ggcgagaaaatctcgcccaagaatccccggaagtctatccggatgggaatcggtcttctg
cccgaggaccgcaagggtcagggcctcgtgttagagcaaccgattcgcaccaacgcgacg
ctggtatcgcagcgggggaacggcttcatcggcgcgaaagcggaacggcgaaaagtcact
gaactgctggagacggttgccactcggtacggctcgatggacgacaacgtggagagcctc
agcggtgggaaccagcagaaggtgtcactggcaaagtggttggcagtggataccgagctc
atcattttggatgagcccactcgaggcgtggatgtcggtgcgaaggtcgagatgtacggc
cttatcaattctcttgcggacagcggggtcggagtcgtcctcgtctcgtcggagatgatc
gagatcatcgggatctgcgaccgggcgctcgtgatgcgagagggagaggtcacgggcgag
ctcaacaaggaagagctgaccgaaagtaatctgatcaaactggcgatgggtgtcgaatca
tga

DBGET integrated database retrieval system