KEGG   Brachybacterium sp. VM2412: CFK38_11770Help
Entry
CFK38_11770       CDS       T05108                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz00020  Citrate cycle (TCA cycle)
brz00190  Oxidative phosphorylation
brz00650  Butanoate metabolism
brz01100  Metabolic pathways
brz01110  Biosynthesis of secondary metabolites
brz01120  Microbial metabolism in diverse environments
brz01130  Biosynthesis of antibiotics
brz01200  Carbon metabolism
Module
brz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
brz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
brz_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:brz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CFK38_11770 (sdhA)
   00650 Butanoate metabolism
    CFK38_11770 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CFK38_11770 (sdhA)
Enzymes [BR:brz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CFK38_11770 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CFK38_11770 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like YjeF_N NAD_binding_8 GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ATG52123
UniProt: A0A291GNP2
LinkDB All DBs
Position
complement(2612824..2614767)
Genome map
AA seq 647 aa AA seqDB search
MSALFTVGDPVVDTQAPDGPIQGRWDARRFEASLISPANRRRRFVIVVGSGLAGGSAGAT
LGEAGYRVEVFCYQDSPRRAHSIAAQGGINAAKDYRNDGDSIRRLYYDTVKGGDYRARES
NVYRLAQVSEAIIDQAVAQGVPFAREYGGLLSTRSFGGVQVSRTFYARGQTGQQLLLGAY
QALERQIEAGTVAMHTRHEMLEVIVIEGRARGIVVRDMVTGEIETHLADAVVLASGGYGN
VFHLSTNAMGCNVTATWRAHRKGALFANPCFTQIHPTCIPVSGEHQSKLTLMSESLRNDG
RIWVPVQKEDARDPREIPESERDYYLERQYPAFGNLVPRDVASRAAKNQCDAGHGVGPGG
RGVYLDFADALDRLGRRTVEDRYGNLFDMYQKITGEDPYQVPMRIYPAIHYTMGGLWVDY
DLQSSLPGLFVIGEANFSDHGANRLGASALMQGLADGYFVLPNTLTDYLASHPLPPEIDA
THPEAQRAVEDVRARIDALLAIKGSRSVDSFHRELGAILWEHCGMERSAEGLQRAITQIR
ALREEYWSDVRVTGTGAELNQTLERAGRVADFFELAELMCIDALHREESCGAHFRTESQT
EGGEARRIDEDFTYVAAWEFTGDDSPPRLHREHLEFEHVELTQRSYT
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctctgttcacggtgggtgaccctgtggtcgacacccaggcccccgacgggccg
atccagggccgctgggacgcgcggcgcttcgaggcgagcctgatcagcccggcgaaccgc
cgcagacgcttcgtgatcgtcgtgggcagcggcctggccggcggctccgccggggcgacc
ctgggcgaggccggctatcgagtggaggtgttctgctaccaggacagcccgcgccgtgcg
cactcgatcgccgcccagggcggcatcaacgccgcgaaggactatcgcaacgacggcgac
agcatccgccgcctctactacgacaccgtcaagggcggcgactaccgtgcacgcgagtcg
aacgtctaccgcctggcccaggtcagcgaggcgatcatcgaccaggccgtggcgcagggg
gtgcccttcgcccgcgagtacggagggctgctgagcacccgctccttcggcggcgtgcag
gtctcccggaccttctacgcccgcgggcagacgggccagcagctcctgctcggcgcctac
caggcgctggagcggcagatcgaggcgggcaccgtcgcgatgcacacccgccacgagatg
ctcgaggtcatcgtcatcgagggcagggcccgtggcatcgtcgtgcgtgacatggtcacc
ggggagatcgagacgcacctggccgatgcggtcgtgctcgcctcgggaggctatggcaac
gtcttccacctctcgaccaatgcaatgggctgcaacgtcaccgcgacctggcgcgcccac
cgcaagggcgccctcttcgccaacccctgctttacccagatccaccccacctgcatcccg
gtcagcggcgagcaccagtcgaagctgaccctgatgagcgagtcactgcgcaacgacgga
cggatctgggtccccgtccagaaggaggacgcgcgggacccgcgcgagatccccgaatcg
gagcgcgattactacctggagcggcagtaccccgccttcgggaacctggtgccgcgcgac
gtcgcctcccgcgccgcgaagaaccagtgcgatgcggggcacggggtcgggcccggcggt
cgcggcgtctacctcgacttcgccgacgcgctcgaccggctgggccggcgcaccgtggag
gacaggtacgggaacctgttcgacatgtaccagaagatcaccggcgaggatccctaccag
gtgccgatgcggatctatccggcgatccactacacgatgggcggattgtgggtcgactat
gacctgcagagctcactgccggggctcttcgtcatcggcgaggcgaacttctccgaccac
ggcgcgaaccgcctcggcgccagcgccctcatgcagggcctggccgacggctacttcgta
ctgcccaacaccctcaccgactatctcgcctcccacccgctgccgcccgagatcgacgcc
acccatccggaggcgcaacgagccgtggaggacgtgcgcgcccgcatcgacgcactgctg
gcgatcaagggcagccgctcggtggactccttccaccgtgagctcggggcgatcctgtgg
gagcactgcgggatggagcgcagcgcggaaggcctgcagcgcgcgatcacccagatccgc
gcattgcgggaggagtactggagcgatgtgcgggtcaccggcacgggagcggagttgaac
cagacgctggagcgggccgggcgggtcgcggacttcttcgagctcgccgagctcatgtgc
atcgacgcgctgcatcgcgaggaatcctgcggtgctcatttccgcacggagagccagacc
gagggcggcgaggcccggcgcatcgacgaggacttcacctacgtggccgcctgggagttc
accggggacgactcgccgccgaggctgcaccgggagcatctcgagttcgagcacgtcgag
ctgacgcagaggagctacacatga

DBGET integrated database retrieval system