KEGG   Brachybacterium sp. VM2412: CFK38_15815Help
Entry
CFK38_15815       CDS       T05108                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz00620  Pyruvate metabolism
brz00680  Methane metabolism
brz01100  Metabolic pathways
brz01120  Microbial metabolism in diverse environments
brz01200  Carbon metabolism
Module
brz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:brz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CFK38_15815
  09102 Energy metabolism
   00680 Methane metabolism
    CFK38_15815
Enzymes [BR:brz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CFK38_15815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATG52830
UniProt: A0A291GRT6
LinkDB All DBs
Position
complement(3519506..3522334)
Genome map
AA seq 942 aa AA seqDB search
MPDPDAIAVPTLTSEFPVIGDDPHIDAPLRATVRRLSTLLGGALADQHGQEMLDLVEQVR
KLTKEAKSSESEASALDVQNRLAALPIEQATTLTRAFSQYFLLANAAEQVYRVRALDERP
STESWVPRTVRAIHEELGADGLQQAVDSLDVRLVFTAHPTEASRRAVLTKLRRISDILGD
ETEDGSVERRRQDRDLAELIETLWQTDELRRHRPTPQDEARNALYYLREIFRQTMPEMLD
DLREELNEHGADMRDDQVPLRFGSWIGGDRDGNPFVTAQVTREVLELQAETAIDFAVEVI
SDLILELSVSSELTGEDEQLLESLREDLSHGTEVDPVQQELYRQEPYRLKLGAMRSKLRA
TQERIRSGDGHVHGRDYRDSAELQDDFRVLRGALRRHGGERVADGALAVAQQVLAASGLN
LATLDVREHSEKHHEVLARLFDRVGELDRHYTELSRSERTVVLGRELGSRRPLVGSAITE
DESILDDATRITYNVFREIRDAHRLYGTSAIETYIISMTHGADDVLAAALLAREAGLISI
AGSEDHRADIGFVPLLEEVSELRHAGEILDELLSDPSYRKIVRLRGDRQEVMLGYSDGNK
DAGVITSQWEIHQAQRSLRDAAARHGVTLRLFHGRGGSVGRGGGPTYDAILAQPYGVLEG
EIKFTEQGEVISDKYMLPSLARENLDLSLAAVLEGSALHTSPRTPAQTLDRFGEVMQSVS
DASFARYRTLVDDENLPEYFVSATPVEQLGDLNIGSRPSKRATSEKGLDGLRAIPWVFGW
TQSRQIVPGWFGAGSGLKAAREAGLEPDLHEMYRNWHFFRTVISNVEMTLAKTDMQIAAH
YVHSLVPERLWYLFDRIREEYELSVAEIERLTGVLGLLDNQPILKRTLAVRDRYLDPISY
MQVAMLQRARAATERGEELSPELQRALLTTINGVAAGLKNTG
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
gtgccagatcccgacgccatcgccgtccccacgttgacgagcgagttccccgtcatcggc
gacgacccccatatcgacgcccccctgcgagccaccgttcgccgcctgtcgaccctgctg
ggcggcgccctcgccgaccagcacggtcaggagatgctcgacctcgtcgagcaggtccgc
aaactcaccaaggaggcgaagtcctccgagtccgaggccagtgccctcgacgtccagaac
cgtctggccgctctgcccatcgagcaggccaccacgctgacccgtgcgttctcgcagtac
ttcctgctggccaacgccgcggagcaggtctaccgggtgcgggcgctggacgagcggccc
tcgacggagtcctgggtgccgcgcaccgtgcgcgccatccatgaggagctcggcgccgac
ggcctgcagcaggccgtggactcgctcgacgtgcgcctggtcttcaccgcgcaccccacc
gaggcctcccgccgggccgtgctgaccaagctgcgccgcatctcggacatcctcggcgac
gagaccgaggacggcagtgtcgagcggcggcgccaggaccgcgacctcgccgagctcatc
gagacgctgtggcagaccgatgagctgcgccgtcaccgtcccaccccgcaggacgaggcg
cgcaacgccctctactacctgcgggagatcttccgccagaccatgccggagatgctcgac
gacctgcgcgaggagctgaacgagcacggcgcggacatgcgcgacgaccaggtgccgctg
cgcttcggctcgtggatcggcggcgaccgtgacggcaatcccttcgtcaccgcccaggtc
acccgcgaggtgctggagctgcaggccgagacggcgatcgacttcgccgtcgaggtgatc
tccgatctgatcctcgagctctcggtctccagcgagctgaccggcgaggacgagcagctg
ctggagagcctgcgcgaggacctctcccacgggaccgaggtcgacccggtccagcaggag
ctgtaccgccaggagccctaccgcctcaagctgggagcgatgcggtccaagctgcgcgcc
acccaggagcgcatccgttccggggacggccatgtccacggccgcgactaccgcgacagc
gccgagctccaggacgatttccgggtgctgcgcggggcgctgcgccgacacgggggagag
cgcgtcgccgacggcgccctcgccgtcgcccagcaggtgctcgccgcctccggtctcaac
ctcgccaccctcgacgtgcgcgagcactccgagaagcatcacgaggtgctggcccgcctg
ttcgaccgggtgggcgagctggatcgtcactacacggagctcagccgctccgagcgcacc
gtggtgctgggccgcgagctcggcagccgtcggccgctggtggggtccgcgatcaccgag
gacgagtcgatcctcgatgacgccacccgcatcacctacaacgtgttccgggagatccgc
gacgcgcaccgcctctacggcacctccgccatcgagacctacatcatctcgatgacccac
ggcgccgacgacgtcctcgcggccgcgctgctggcccgcgaggcggggctgatcagcatc
gccggcagcgaggaccaccgggccgatatcggcttcgtgccgctgctcgaggaggtctcg
gagctgcgccacgccggtgagatcctcgacgagctgctgagcgacccctcctaccggaag
atcgtgcgcctgcgcggcgaccgccaggaggtcatgctcggctactccgacggcaacaag
gacgccggcgtgatcaccagccagtgggagatccaccaggcgcagcgctcgctgcgcgat
gcggcggcccgccacggggtgaccctgcggctgttccacggtcgcggcggttccgtcggc
cgcggcggcggtcccacctacgacgcgatcctggcccagccgtacggcgtgctcgagggc
gagatcaagttcaccgagcagggcgaggtcatctccgacaagtacatgctgccctcgctg
gcccgggagaacctggacctgtcgctggccgcggtgctcgagggctcggcgctgcacacc
tcgccccgcaccccggcgcagaccctcgaccgcttcggcgaggtcatgcagtcggtctcc
gatgcgtccttcgcccgctaccgcacgctggtcgacgacgaaaacctgccggagtacttc
gtctccgccaccccggtggagcagctcggcgatctgaacatcggctcgcgaccctcgaag
cgggccacctcggagaagggcctggacggcctgcgggcgatcccgtgggtgttcggctgg
acccagtcgcggcagatcgtgcccggctggttcggcgccggctccgggctgaaggccgcg
cgggaggccgggctcgagcccgacctgcacgagatgtaccgcaactggcacttcttccgc
accgtgatcagcaatgtcgagatgacgctggcgaagacggacatgcagatcgccgcccac
tacgtgcactcgctggtgccggagcggctgtggtacctcttcgaccggatccgggaggag
tacgagctctcggtcgcggagatcgagcggctcaccggcgtgctgggcctgctggacaac
cagccgatcctcaagcgcaccctggcggtgcgcgaccgctacctggatccgatctcctac
atgcaggtcgcgatgctgcagcgggcccgggccgccacggagcggggcgaggagctctcg
cccgagctgcagcgcgcgctgctgaccaccatcaacggcgtcgccgcggggctgaagaac
accggctga

DBGET integrated database retrieval system