KEGG   Brachybacterium sp. VM2412: CFK38_15900Help
Entry
CFK38_15900       CDS       T05108                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
brz  Brachybacterium sp. VM2412
Pathway
brz03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:brz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CFK38_15900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:brz03400]
    CFK38_15900
Enzymes [BR:brz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CFK38_15900
DNA repair and recombination proteins [BR:brz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CFK38_15900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ATG52845
UniProt: A0A291GRH9
LinkDB All DBs
Position
complement(3536112..3538595)
Genome map
AA seq 827 aa AA seqDB search
MASHEQHVEVDGHRLRLSNLDKVLYPATGTTKGEVIQYYHRIAPLLIPQASRRPATRKRW
VDGVGTAEKPGTVFFRKDLEDHAPDWLPRADLEHNDGISTYPLVDEPAVLVWLAQLAALE
IHTPQWRFDGDLEPAHPDRLVLDLDPGEGAGLPQCAQVASWCREILTDMGLEAYPVTSGS
QGLHLYAPLDGETTAREVSQVARRLARALEEDHPEEVISTQTRSQRAGKVLVDWSQNNGS
KTTVCPYSLRGRLRPTVAAPRTWEEIEDPDLAQLELDEVLARAEDGVDPIAPLGLASSAD
PSAAAPRDRLELYRAKRDPERTPEPVPAARAGGEAAQEALEDAEPMFVIQEHHASRLHWD
FRLQHSGVLVSWAVPKGPPLETEVNRLAVRTEDHPLEYGTFEGSIPKDEYGGGDVTIWDT
GAIEIEKWREGEEVIVVCHGAADGGLGGVPRRFAFIRTGGMGGRSRSAAAKEKAKDNWLL
HLMKDQPEAGDTNADTDTEIERGEPIAPMLATLGRRADIRDEDEWAFEMKWDGVRVIATV
AGGAVRLTSRGGKDMTATFPELAELHEAVDAALRTAGETVLDGEIVALDSRDRPSFSRLQ
QRLGLTRQRDVQRAREDVEVHVMLFDLLVRGGDSLLRRPYRERREALFAAVGATEHVQLP
HADHGDVDHAIELSQTLQLEGVMAKQESSVYQPGKRSRTWLKLKNARHQEVVVIGWRHGK
GERRGGIGSLLVAVPDAEGELHYAGRVGTGFTARDLEQIGGRLRSRARKTPPAADVPAAD
RRDAEWVRADLVGEVQHTERTEDSRLRHPVWRGWRPDKEAADVRWEA
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggccagccacgagcagcacgtcgaggtcgacggccaccggctgaggctgtccaacctc
gacaaggtcctctatcccgccacgggcaccaccaagggcgaggtgatccagtactaccac
cgcatcgccccgctgctgatcccgcaggcctcccgccgccccgccacccggaagcgctgg
gtggacggcgtgggcaccgccgagaagcccggcacggtgttcttccgcaaggacctcgag
gaccatgctccggactggctgccccgtgcggacctcgagcacaacgacggcatctccacc
tatccgttggtggacgagcccgcggtgctggtgtggctcgcccagctcgccgcgctcgag
atccacaccccgcagtggcgcttcgacggggacctcgagcccgcacaccccgaccgtctg
gtcctggacctcgaccccggcgagggcgcgggactgccccagtgcgcgcaggtcgcgtcc
tggtgccgcgagatcctcaccgacatgggactggaggcgtatcccgtcacctcgggctcc
cagggcctgcacctctacgccccgctggacggcgagaccacggcccgggaggtctcgcag
gtcgcgcgccgtctcgcccgcgccctggaggaggaccaccccgaggaggtcatcagcacc
cagacccggtcccagcgcgccggcaaggtgctcgtggactggtcgcagaacaacgggagc
aagaccaccgtctgcccgtactccctgcgcggtcggctgcgccccaccgtcgccgccccg
cgcacctgggaggagatcgaggaccccgatctcgcccagctcgagctggacgaggtgctc
gcgcgcgccgaggacggcgtcgacccgatcgcaccgctcggcctcgcctcgagcgccgac
ccgtcggccgccgcgccccgcgaccggctcgagctgtaccgcgccaagcgcgaccccgag
cgcacccccgaaccggtgccggccgcccgtgccgggggcgaggccgcacaggaggcgctc
gaggacgcggagccgatgttcgtgatccaggagcaccacgcctcgcgcctgcactgggac
ttccgcctgcagcactccggggtgctggtgtcctgggcggtgcccaaggggccgccgctg
gagaccgaggtgaaccgcctcgccgtgcggaccgaggaccatccgctcgagtacggcacc
ttcgagggcagcatcccgaaggacgagtacggcggcggcgacgtcaccatctgggacacc
ggcgccatcgagatcgagaagtggcgcgagggcgaggaggtgatcgtggtctgccatggt
gcggccgacggcggtctcggcggcgtcccgcgccgcttcgcgttcatccgcaccggcggc
atgggcgggaggtcccgctccgcggcggcgaaggagaaggcgaaggacaactggctgctg
catctgatgaaggaccagccggaggccggcgacaccaatgccgacaccgacaccgagatc
gagaggggcgagccgatcgcgccgatgctcgccaccctcggccggcgcgcggacatccgt
gacgaggacgagtgggccttcgagatgaagtgggacggggtccgcgtcatcgccaccgtc
gcgggcggggcggtgcggctcaccagccgcggcggcaaggacatgaccgcgaccttcccg
gagctcgccgagctgcacgaggccgtggacgccgcgctgcgcacggcgggggagaccgtc
ctggacggagagatcgtcgccctggacagccgcgaccggccctccttctcccgcctgcag
cagcggctcgggctcacccggcagcgggacgtccagcgggcccgagaggacgtcgaggtc
cacgtgatgctcttcgacctgctggtgcgcggcggggactcactgctgcgccgtccctac
cgcgaacgtcgcgaggcgctgttcgcggcggtgggcgccaccgagcacgtgcagctcccg
cacgccgaccacggcgacgtggaccatgcgatcgagctctcgcagacgctgcagctcgaa
ggggtgatggcgaagcaggagtccagcgtctaccagccgggcaagcgctcgcgcacctgg
ctcaagctcaagaacgcccgccaccaggaggtggtggtgatcggctggcgccacggcaag
ggggagcgccgcggcggcatcggctcgctgctggtcgcggtgcccgacgccgagggagag
ctgcactacgcgggccgggtcggcaccggcttcaccgcgcgcgacctcgagcagatcggg
ggccgcctgcgctcccgcgcccggaagacaccacccgccgccgatgtgcccgccgcggac
cgccgcgacgccgagtgggtgcgggcggacctggtgggcgaggtccagcacaccgagcgc
accgaggacagccggctgcgccaccccgtctggcgcggctggcgccccgacaaggaggcc
gcggacgtgcgatgggaggcctga

DBGET integrated database retrieval system