KEGG   Bacteroides salanitronis: Bacsa_0701Help
Entry
Bacsa_0701        CDS       T01433                                 

Definition
(GenBank) Glycoside hydrolase 97
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00500  Starch and sucrose metabolism
bsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bacsa_0701
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Bacsa_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ADY35295
UniProt: F0R140
LinkDB All DBs
Position
761908..764061
Genome map
AA seq 717 aa AA seqDB search
MKKLLLTAGILLTSLLGKAEGITSPSGIVKVDFELTGNGVPTYSVAYKDRPVVKPSTLGL
ELNGQSNLMDGFEVVKTSTSTFDETWQPVWGETKDIRNHYNELLVELRQPTTDRYMNIRF
RVYDEGMGLRYEFPTQKNLIYFVIKEEHTQFAMTGDHTAWWIPGDYDTQEYDYTESRLSE
IRGLLEKAYTSNLSQTMFSNTGVQTSLQMKTDDGLYINLHEAALVDYSCMHLNLDDKNMV
FESWLTPDAQGNKGYMQAPCHTPWRTVMVSDDARDILASKLILNLNEPCKLEDTSWIKPV
KYIGVWWEMITGKSAWSYTNDLPSVKLDEIDYTKVKPHGNHGANNENVRRYIDFAAQHGF
DQVLVEGWNIGWEDWFGNSKDYVFDFVTPYPDFDIKALNEYAHNKGVRLMMHHETSASIR
NYERHLRDAYELMEKYGYNSVKSGYVGNIIPRGEHHYGQWMVNHYLYAVKEAAKHHIMVN
GHEAVRPTGLCRTYPNLIGNESARGTEYEAFGGSKPFHTTVLPFTRLQGGPMDYTPGIFE
MEISKLNPNNHSHVNSTLVRQLALYVTLYSPLQMAADIPENYERFMDAFQFIKDVAVDWD
DSRYLEAEPGQYITVARRAKGTNDWFIGCTSGENGHDSELRFNFLDTDKTYIATIYADAP
DAHYKNNPQAYIIHKGTITAKTTLKLKAAPGGGYAISICEASKEESKGLKRLSGNIH
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactattattaacggcaggcattctgctgacttcccttttagggaaagccgaa
ggaattacatccccttccggcatagtgaaagtcgatttcgagttgacaggaaacggtgtc
ccgacttacagcgtggcatacaaagaccgtcctgtagtgaagcccagcaccttaggatta
gagttgaatggacaaagcaatctgatggatggttttgaggttgtgaaaacgtccacctct
actttcgacgaaacatggcaacccgtgtggggagaaacgaaagacatccgtaatcattac
aatgagttgctggtggaactgcgccaacccactaccgaccgctatatgaacatccgattt
cgtgtgtatgacgagggaatggggttacgttatgaatttccgacacaaaagaacttgatt
tattttgtcattaaagaagagcatacccaatttgccatgaccggcgatcataccgcctgg
tggattcccggcgactacgatacgcaggagtatgattacacagaaagccgtctgtctgaa
atcagaggattgctggagaaagcatatacaagtaatctgtcgcaaacgatgttttcgaat
acaggcgttcagacttctttgcagatgaagacagacgatggactgtatatcaatctgcac
gaagccgctttggtggactactcgtgtatgcatcttaatctggatgataagaacatggtt
ttcgaatcctggctgactcccgatgcgcagggaaacaaaggatacatgcaagctccgtgc
cataccccttggcgtacggtaatggttagcgatgatgcccgcgacatcttggcttctaaa
ctgattttgaacctgaacgagccgtgcaagctggaagatacttcgtggataaagcctgta
aagtatatcggtgtatggtgggaaatgataacgggcaaaagtgcctggtcgtacaccaat
gacctgccatcggtgaaactggacgaaattgattatactaaggtgaaacctcacggtaat
catggtgccaataacgaaaacgtaagacgctatatcgactttgccgcacaacatggtttc
gaccaagtgctggtagaaggatggaacatcggttgggaagactggttcggcaacagcaag
gattatgttttcgattttgtaacgccctatcctgatttcgacatcaaagccttgaacgaa
tatgcgcataataaaggtgtgcgtctgatgatgcatcatgaaacttcagcgtctatccgt
aactatgaacggcatttgcgcgatgcctacgaactgatggagaaatatggatataattcg
gtgaaaagcggatatgtaggcaacatcattcctcgcggtgagcaccattacggacaatgg
atggtcaatcattatttgtatgccgtaaaggaagcagccaaacatcatattatggtgaac
gggcacgaggcagtacgccctacaggcctatgccgtacctatcctaatttaatagggaat
gaatctgcccgtggaacagaatacgaagcttttggcggaagcaaacctttccatacaacg
gtcttgcctttcacacgcctgcaaggcggtccgatggattatacgccggggattttcgag
atggaaatcagcaaactgaaccccaataaccattcgcatgtcaactctaccttggtgcgt
cagttagctttgtatgtcacattatacagtccgctccaaatggctgccgacattcctgaa
aactatgaacgttttatggatgccttccagtttatcaaagatgtagctgtagattgggat
gacagccgctatttagaagctgaaccaggacaatacatcacagtggcacgccgcgcgaaa
ggaactaatgactggtttattggctgtaccagtggcgagaacggacacgactctgaatta
agattcaatttcttggatacagacaaaacctatattgctacaatttatgccgatgctcct
gacgctcattataaaaataatccgcaagcatatattattcataaagggactattactgct
aaaacaacattgaagctgaaagcagctcccggtggaggatatgccatcagtatatgcgaa
gcctcaaaagaggagagtaaaggactaaagcgtctttcaggaaatattcattaa

DBGET integrated database retrieval system