KEGG   Bacteroides salanitronis: Bacsa_0882Help
Entry
Bacsa_0882        CDS       T01433                                 

Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00052  Galactose metabolism
bsa00511  Other glycan degradation
bsa00600  Sphingolipid metabolism
bsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bacsa_0882
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bacsa_0882
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bacsa_0882
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bacsa_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: ADY35474
UniProt: F0R2S9
LinkDB All DBs
Position
complement(989051..991555)
Genome map
AA seq 834 aa AA seqDB search
MKKLASLLCGVCCLLLASCAASPEKVREKIDFNDGWRFLLGDEPQAEEVGFADTAWRALD
LPHDWAIEGDFSQDNPSGTGGGALPGGIGWYRKTFVPDKADADKKFRIVFDGVYMNSEVF
LNGVSLGHRPYGYITFSYDLTPHLKWGEKNVLAVRVDNSEQPNSRWYSGCGIYRNVWLVK
TGAVHVAEWGTYATVSEVSDAQADLDIQTRVANESAMPAQVKVHSSLLDAEGLIVASGET
DCFVEAGKETEVSQQLKVGNPERWDIDTPYLYTLLTEVVQEGKQVDRYETPVGIRSFSFD
AEKGFILNGRPMKINGVCMHHDLGCLGAAVNVRAMERQLEILKEMGCNGIRCSHNPPAPE
LLDLCDRMGFIVMDEAFDMWRKKKTSHDYARYFDEWYERDLRDFILRDRNHPSIFIWSIG
NEVLEQWSDAKADTLSLEEANLILNFGHSADMLAKEGEMSVNSLLAKRLAEFVKALDPTR
PITTGCNEPNPANHLFKSGAMDIIGYNYHNANIPDVPKNFPNKPFIITESNSALATRGYY
RMPSDKVTVCPDRWDKPYYDPTFACSAYDNCHVPWGNTHEETIKLIRDNAFISGQYVWTG
FDYIGEPTPYGWPARSSYFGIVDLAGFPKDAYYLYQAEWSDKPVLHLFPHWNWTPGQDID
MWCYYNNADEVELFVNGKSQGVKAKTPDCLHAAWRVKFEPGSVKVVARKEGKVVGEKEIR
TAGTPAQIRLTPDRSNLYADGRDLSFVTVEILDKDGNLCPNADNLVRFQVEGNAFIAGVD
NGSPISMERFKDNKRKAFYGKCLVVLQNTGDAGGARLKAVSDGLRDAEVSITAE
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattagcttctcttttatgcggagtatgttgcctgcttttagcttcgtgtgcg
gcatctccggaaaaagtccgcgagaagatagacttcaacgacggctggcgtttcctgtta
ggagacgaaccgcaagcggaagaagtcggttttgctgatacggcgtggcgtgcgctcgac
ttgcctcatgattgggcgatagagggcgacttcagtcaggataatccgtccggtacaggc
ggaggggctttgcccggaggcatcggatggtaccgtaagactttcgttcccgataaagcc
gatgcggataagaagttccgtatcgtgtttgatggggtctatatgaattcggaagtattt
ctcaacggtgtgtctctggggcatcgtccgtatggatacattactttcagttacgacctt
accccgcatctcaagtggggcgaaaagaatgtgcttgccgtgcgtgtggacaattccgaa
cagcctaattcacgctggtattcgggatgcggcatttaccggaatgtatggctggtgaag
accggtgcggtgcatgtggcagaatggggaacgtatgctacggtgagtgaggtgagtgat
gcgcaggcggatttggatattcagacccgtgtagcaaatgaatcagctatgcctgctcag
gtgaaggtgcattcttctttgctggatgcggaagggcttatcgttgcaagtggagaaacg
gactgtttcgtagaagccgggaaggaaaccgaggtctcgcaacagctaaaggtcgggaat
cccgaacggtgggatattgatacaccttatttatataccttattgaccgaagtggtacaa
gaagggaaacaggtcgaccgttatgaaacgcctgtaggtatccgttcgttttcttttgat
gccgaaaagggatttatccttaacggaagaccgatgaagataaacggggtatgtatgcat
cacgatttgggatgcttgggagcggcggtcaatgtgcgtgccatggaacgccagctggaa
atcctgaaagagatgggatgcaacggcatccggtgttcgcacaatcctcctgcgcccgaa
ttgctcgacttgtgcgaccggatggggttcatcgtcatggatgaggcgttcgacatgtgg
cgcaagaagaagacctcgcacgactatgcccgctattttgatgagtggtatgaacgggat
ttgcgcgatttcatcttgcgcgaccgcaaccatccctccatatttatttggagcatcggc
aacgaagtgttggagcagtggagcgatgccaaagccgatacgttaagtctggaagaagcg
aacctgattctgaacttcgggcattcggcggatatgttggcaaaagaaggggagatgagt
gtcaattcattgctggcgaagaggctggctgagtttgtaaaggcactcgacccgacacgt
cccattacgaccggatgcaatgaaccgaatccggcaaaccatttgttcaagtcgggagct
atggacattatcgggtacaattatcataacgcgaatattcccgatgtgcctaagaatttc
cctaacaagccttttataatcaccgaaagcaattcggctcttgccacacgcgggtattac
cggatgccgagcgataaggttaccgtttgtcccgaccgttgggacaagccgtattacgac
ccgactttcgcttgctcggcatatgacaattgccatgtgccttggggaaacacgcatgag
gaaactataaagctgattcgtgacaatgctttcatcagcgggcaatatgtgtggacggga
ttcgactatatcggcgagcctactccttacggatggcctgcacgcagctcgtattttggc
atcgtcgaccttgccggatttccgaaggatgcctattacctctatcaggcggagtggtcg
gacaagcctgtgctccatcttttcccgcactggaactggacgccgggacaggatattgat
atgtggtgctattacaacaatgccgacgaggtggaactttttgtcaacggcaagtcgcaa
ggcgtgaaggcgaagactcctgattgcctgcatgcggcatggcgtgtcaagttcgagccg
ggaagcgtgaaggtggtggcacgtaaagaaggaaaggtagtaggcgagaaagaaatccgt
acagccggaacccctgcccaaatccgcctgactcccgatcgttccaacttgtatgccgat
gggcgtgacttgagtttcgtaacggtagagattttggataaggatggcaatctgtgtccg
aacgccgacaatttggtccgttttcaggtagaaggcaatgcttttatagccggagtggat
aacggaagccccatttcgatggagcggttcaaggacaataagcgcaaggctttttacggc
aagtgcctcgtggtattgcaaaacacgggagatgccggaggtgcccgcctgaaggcggtt
tccgatggcttgcgtgatgccgaagtatcgataacagcagaataa

DBGET integrated database retrieval system