KEGG   Bacteroides salanitronis: Bacsa_1763Help
Entry
Bacsa_1763        CDS       T01433                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00473  D-Alanine metabolism
bsa01100  Metabolic pathways
bsa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bacsa_1763
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Bacsa_1763
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsa01011]
    Bacsa_1763
Enzymes [BR:bsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Bacsa_1763
Peptidoglycan biosynthesis and degradation proteins [BR:bsa01011]
 Precursor biosynthesis
  Racemase
   Bacsa_1763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C Peptidase_S10
Motif
Other DBs
NCBI-ProteinID: ADY36322
UniProt: F0R194
LinkDB All DBs
Position
complement(2037002..2039473)
Genome map
AA seq 823 aa AA seqDB search
MSSSIEEIVSVVGATRIGERQASISWILTDSRSLCFPEETLFFALKAKRNDGHKYIPELY
ARGVYNFVVAEVPEEMKNCTDVNFLVVGNVLKALQRLAGKHREQYQVPVIGITGSNGKTV
VKEWLYQLLSPDKRIIRSPRSYNSQIGVPLSVWMMDEHTELGIFEAGISEMGEMETLEPI
IRPTIGVLTNIGGAHQENFSSLQDKCMEKLLLFKECDVIVYNGDNELIRDCVSKSLFTAR
EIAWSMKDPERPLFIEKIEKDAAGTTIKYRYLGFFKEFRIPYIDDASIENSLHCLAVALY
LMVPTEVIAERMAHLEPVAMRLEVKEGKNGCVLINDSYNSDFASLDIALDFMARRSEDKA
RRRTLILSDILETGQPGKLLYRQVAELVHSRGVDRLIGVGEEISASSSRFDVKEKQFFLT
TEELMASGVLETLRNDIVLIKGARAFHFDAVSDFLELKVHETILEINLNALVDNLNYYRN
KLKPETKLMCMVKASAYGAGPFEVAKTLEEHRVDYLAVAVADEGADLRKAGITCPIVIMN
PEATAFKTMFAYRLEPNIYGFPILEEMIKAAEREGVSNFPIHIKIDTGMHRLGFSPHQDM
QRLVERLHRQSAVIPRSVFSHLAGSDSERFDAFTRKQIETFEAAAAELQAGFGVKILRHV
CNTAGIERYPGAQFDMVRLGIGLYGIDPFTNHILHNVSTLKTTILQIHDIPADETVGYSR
KGVLYRDSRIATIPIGYADGLNRHLGNGHAYCLVNGKKAPYVGNICMDVCMIDVTDIDCK
EGDKAIIFGDDLPVTVLAEALGTIPYEILTSVSNRVKRVYFQG
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcgattgaagaaatagtctctgtggtgggggcaacccgtatcggagagcgg
caagcatccatcagttggattctgaccgatagccgttcattgtgtttcccggaggaaacg
ctttttttcgcattgaaggccaaacgcaatgacgggcataaatacatcccggaattgtat
gcgcgaggtgtgtataactttgtggttgcagaggttccggaagaaatgaaaaactgcacc
gatgtgaattttctggtggtaggcaatgtgttgaaagccctgcaacgccttgcggggaaa
catcgggaacaatatcaggtgcccgtaatcggaataaccggaagcaatggaaagaccgtc
gtgaaggaatggctttaccagttgttgagtccggacaagcgaatcatccgttcgccgcgc
agctataattcgcaaatcggagtgcctttgtctgtatggatgatggacgaacataccgaa
ttgggaatcttcgaagccggtatttctgaaatgggtgaaatggaaaccttggagccgatt
atccgtccgactatcggtgtgctgaccaatatcggcggggcgcatcaggaaaatttctct
tcgttgcaggacaagtgcatggaaaagctgcttttgttcaaggaatgtgatgtgatagtg
tataacggcgataacgaactgattcgggattgcgtgtcgaagtccttgtttacagctcgt
gaaatcgcatggtcgatgaaggaccctgaacgtccgctttttatcgagaaaatcgaaaaa
gatgcggcgggcactaccatcaagtaccgttatctgggtttttttaaggaattccgcatc
ccttatatcgacgacgcttcgattgaaaattcattgcattgcctggcggtggctttgtat
ctgatggtacctacggaggtgatagccgagcggatggcacatctggaaccggtggctatg
cgtctggaggtgaaagaaggcaaaaacggctgtgtgttgataaacgatagttataactcg
gatttcgcttcattggatatcgcgcttgatttcatggcgagacgttcggaagataaagcg
cgccggcgcacattgattttgtcggatatcctggagacggggcagccgggcaaattgctc
taccggcaagtggcagaactggtgcatagccgcggagtagaccggctgattggagtaggc
gaggagatatccgcatcgtcttcccgtttcgatgtgaaggaaaagcagttcttccttacg
actgaagagctgatggcatcgggtgtgctggaaacgttgcggaatgacattgtattaata
aaaggtgcacgcgctttccattttgacgccgtttcggattttctggaactgaaagtacat
gagacgattctcgaaatcaacctgaatgcgttggtggataacctgaattattaccgcaat
aagctgaagccggaaacgaagctgatgtgcatggtgaaggcatcggcgtatggagccggt
ccgttcgaagtggcaaaaacattggaagagcatcgggtggattacctggcggtagctgtg
gcggatgaaggtgccgacttgcgcaaggcaggcattacgtgtccgattgtgattatgaat
cctgaagctacggcattcaagaccatgttcgcttaccggctggagccgaatatttacgga
ttcccgatactggaggaaatgataaaggcagcagaacgtgaaggggtgtctaatttcccg
attcatatcaaaatagatacgggtatgcaccgtttgggattctctccgcatcaggatatg
cagcgcctggtagaacgtttgcaccgccagtcggcggttattccccgttcggtcttctcg
catttggcaggaagcgactcggagcgcttcgatgcgtttacacggaaacagattgagacg
ttcgaagccgcggcggctgagctgcaagccggattcggggttaaaatcttgcgtcatgta
tgcaatacggcaggcatagagcgttatccgggagcacagttcgacatggtgcggctgggc
atcgggctgtatggcatagacccgtttaccaaccatattttacataatgtaagcacgttg
aaaaccaccatcttgcagatacatgatattccggcggatgagactgtaggttatagccgg
aaaggggtcttgtaccgcgactcgcggattgccactatccctatcggatatgccgacggg
ctgaaccggcatttgggcaacgggcacgcttattgcctggtgaacgggaagaaggcaccc
tatgttggcaatatctgcatggatgtatgcatgattgatgtgacggatattgattgcaag
gaaggggacaaggctatcatctttggagatgatttgccggtgacggtactggctgaggca
ctcggtaccatcccttacgaaatcctgaccagcgtgtccaatcgggtaaagcgtgtctat
tttcaggggtag

DBGET integrated database retrieval system