KEGG   Bacteroides salanitronis: Bacsa_1984Help
Entry
Bacsa_1984        CDS       T01433                                 

Definition
(GenBank) Beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00052  Galactose metabolism
bsa00511  Other glycan degradation
bsa00600  Sphingolipid metabolism
bsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bacsa_1984
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bacsa_1984
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bacsa_1984
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bacsa_1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4982 Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Glyco_hydro_42 Invasin_D3
Motif
Other DBs
NCBI-ProteinID: ADY36540
UniProt: F0R2Y4
LinkDB All DBs
Position
2297639..2300113
Genome map
AA seq 824 aa AA seqDB search
MKKKVLLCLLSFCSLFAWAQRQETLLEKNWKFTKGDAPEAVQETFDDTQWETVTVPHDWA
IYGPFDRSHDLQNVAVKQNFETQASVKTGRTGGLPYVGTGWYRTTFEVPAGKEASLVFDG
AMSEARVYVNGKEAGFWPLGYNSFHIDVTPYIYTDGRKNTLAVRLENRPQSSRWYPGAGL
YRNVRLVTTEKVHVPVWGTQLTTPHVEASYASVKLLTTVAHAGDKDIRIVTEILSPEGKV
VAVKDNTRKINHGMPFEQNFLVDAPKLWSPETPFLYKAVSKIYVDNRQVDEYTTRFGIRS
LEIVPDKGFFLNGKHRKFQGVCNHHDLGPLGAAVNVAALRRQLTMLKDMGCDAIRTAHNM
PAPELVELCDEMGFMMMLEPFDEWDIAKCENGYHRFFGEWAEKDMVNMLRHYRNHPSVVM
WSIGNEVPTQWKPEGYKVASFLQDICHREDPTRPVTCGMDQVSSVLGNGFAAMLDVPGFN
YRAHRYVEAYNRLPQNIVLGSETSSTVSSRGVYKFPVRKRGDAKYEDHQSSGYDLEHCSW
SNVPDEDFALADDYPWTIGQFVWTGFDYLGEPSPYDTDAWPSHSSLFGIIDLASLPKDRY
YLYRSIWNRKSPTLHVLPHWNWQGREGENTPVFAYTSYPEAELFVNGKSYGKQRKLTREE
SQALQGKDSLWLQRRYRLMWMDVPYEPGELKVVAYDASGKAADEKVVRTVGKPHHIELVA
DRTELAADGKDLAYITVRIVDKDGNLCPMDNRLVHFSVKGAGTYRASANGDPTCLYLFHE
NRMPAFSGALTAIVQTKEEAGEICFEAKAKGVKGGKLTLRTVRE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaagtacttttgtgtttgcttagtttctgttcgctctttgcatgggcgcaa
aggcaagagacattgttagagaagaactggaaattcacgaaaggtgatgcgcctgaggct
gtgcaagagacgtttgacgatacgcaatgggaaaccgtgaccgtgccgcatgactgggct
atctatggtccgttcgaccggagccatgacctgcagaacgtggcggttaagcagaacttc
gagacgcaggcttcggtgaagaccggacgtaccggaggacttccctacgtaggcacaggc
tggtatcgcaccaccttcgaagtgcctgcgggcaaagaggcttccctggtgttcgatggt
gccatgagcgaggcgcgggtttacgtgaacggaaaagaagcgggcttctggccgctgggg
tataattcgttccacattgacgtgacaccttatatctatacggacgggcggaagaatacg
ctggcagtacgtttggaaaaccgcccgcagtcttcgcgctggtatccgggggcagggctt
taccggaacgtgcgactggtgactacagaaaaggtgcatgtgcctgtatgggggacgcag
cttactacgcctcatgtggaagccagctatgcctcggtgaagctgcttaccaccgttgcc
catgcaggggataaggatatccgcatcgtgacggagattctctcacccgaagggaaggtg
gtagcggtgaaagacaatacgcgcaaaatcaatcacggaatgccctttgagcagaacttt
ctggtagatgctccgaagttgtggtcgcccgaaacgcctttcttgtataaggcggtatct
aagatttacgtggataaccggcaggtggacgaatacacgacccgtttcggcatccgcagc
ctggagattgtgcccgacaagggtttcttcctgaacggaaagcaccgcaagttccaaggg
gtgtgcaaccatcacgacctcggtccgctgggggctgccgtgaatgtggctgccctgcgc
cgccagctgacgatgttgaaggacatgggttgcgacgcgatacgtaccgcccacaacatg
ccggctcccgaactggtggaactgtgcgacgagatgggctttatgatgatgctggagccg
ttcgacgaatgggatatcgccaagtgcgagaacggttatcaccgcttcttcggcgaatgg
gcggagaaagacatggtgaacatgttgcgccattaccgcaaccatcccagcgtggtgatg
tggagcatcggcaacgaggtgcctacccagtggaagcccgaagggtataaggtggcttcg
ttcctgcaggacatctgccaccgcgaagaccctacgcgtccggtcacatgcggcatggac
caggtgtcgagcgtgttgggcaatgggtttgccgccatgctggatgtgcctggattcaat
taccgtgcccaccggtatgtagaagcctacaaccgcctgcctcagaacattgtgctgggc
tcggaaacatcctctacggtcagctcgagaggggtgtataagttcccggtacggaagcgc
ggcgatgccaagtacgaagaccatcagtcgagcggatatgacttggagcattgttcgtgg
agcaacgtgcccgatgaggatttcgcccttgccgacgattatccgtggaccatcggccag
ttcgtatggacgggtttcgattacttgggcgaaccttcgccttacgataccgatgcctgg
cccagccatagctcgttgttcggcattatcgacctggcaagcctgcccaaagaccgctat
tacctctatcggagtatctggaacaggaaatcacctaccctgcacgtgttgccgcactgg
aactggcagggcagggaaggcgaaaacacgccggtatttgcctacaccagttatcccgaa
gcggaactgttcgtgaacggcaagagctatgggaagcagcgcaagctgacgcgcgaagaa
agccaagccctgcagggcaaggattcgctttggctccagcgccggtatcggctgatgtgg
atggatgtgccatacgagccgggcgagctgaaagtagtggcttatgatgcatccggaaag
gcggcggacgaaaaggtagtgcgtacggttggcaagcctcaccacattgagctggtggca
gaccgtacggagctggcggcagacgggaaagaccttgcctacatcacggtgcgcatcgtg
gacaaggatggcaatctgtgtccgatggacaaccgcctggtacacttctcggtaaagggg
gcaggcacgtatcgtgcttcggcaaacggcgaccctacctgtctctatctgttccacgaa
aaccggatgccggccttcagcggcgcattgaccgccatagtacagactaaagaagaagcc
ggagaaatctgtttcgaggcgaaagcaaagggtgtgaagggcggcaagctgaccttgcgc
acggtgcgtgaatag

DBGET integrated database retrieval system