KEGG   Bacteroides salanitronis: Bacsa_2125Help
Entry
Bacsa_2125        CDS       T01433                                 

Definition
(GenBank) Glycoside hydrolase 97
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bsa  Bacteroides salanitronis
Pathway
bsa00500  Starch and sucrose metabolism
bsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bacsa_2125
Enzymes [BR:bsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Bacsa_2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C DHquinase_I
Motif
Other DBs
NCBI-ProteinID: ADY36680
UniProt: F0R464
LinkDB All DBs
Position
2443431..2445542
Genome map
AA seq 703 aa AA seqDB search
MKRLSMICLFLLVWAGTMFAQTLKSPDGNLTLQFRLSAEGTPVYSLQYKGKDVIKESKLG
FSVRPDYQFDRNFTVTDTQTSESNTTWKPVWGQYSEIRDHHNELFIAMKQNGTGWLLNLR
FRLFNDGLGFRYEFPVQKELRHFTVNEEETEFRLTGDHKAFWLPGDYDTNEYPTTTSKLS
EVASLIDSVRQEPLAIRSATPNLAVQSPLMLKSAEGLYINIHEAALVNYPAMQLNLDDKG
FVLSTHLTPDRNGTKAYVQTGSVTPWRTIVVSDDARDILASNLILNLNEPCKLADTSWIH
PTKYVGVWWEYFTGQGSTWAYTDTQDIVIGKTDYTKLKPNGHHGANTAHVKEYIDFAAKH
GFDAVLVEGWNEGWEDNYAYSKEFIYDFDKPYPDFDVAELQRYAQEKGVKIIMHHETTSS
VADYERQMHDAFRFMNKYGYDAVKTGYVGGIIPRSEHHDGQWMVNHYLRVAKTAAQYKIM
VNSHEAVRPTGLCRTYPNWIAQESARGTEFESFKGNRPDHTTILPFTRLMGGPMDYTPGI
FEGDLSQYGSNQAKLSTTLVKQLALYVTMYSPLQMAADLYQSYEKHLDAFQFIKDVAVDW
DNTYILEAEPGDYITIARKAKGKNEWYIGGITDENAREAVIDLSFLPEGKKYEATIYADG
KKADWRTNPQDYVISTKKVSSKTMLKQRLAPSGGVAISIKELE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactaagcatgatttgcctgttcctgctcgtctgggctggaacaatgtttgca
cagacactgaaatcgccggacggaaacctgaccctgcagttccgcctttcggctgaaggt
acaccggtctattccttgcaatacaaaggaaaagatgtcatcaaggagagcaagttggga
ttcagcgtgcgtcccgattatcaattcgaccgcaactttacggtgaccgacacacaaact
tcggaaagcaacactacctggaagcccgtatggggacaatacagtgaaatccgcgaccac
cataacgaattgttcatcgccatgaagcaaaatgggacgggctggctgctgaacctccgt
ttccgtctgttcaatgacgggctgggattccgctatgagttcccggtgcagaaagaactg
cgccattttacggtgaacgaagaagagaccgaattccgcctgaccggcgaccataaggcg
ttctggcttccgggcgactatgatacgaacgaatatcccactacgacttcgaaactctcg
gaagtggcaagcctgattgacagcgtgcgccaggaaccgctcgccatccgttcggctacc
ccgaaccttgccgtacaatcgccgttgatgctgaaatcggctgaaggattatacatcaat
atccacgaagccgcactggtgaactatcctgccatgcagctgaatctggatgacaaaggc
ttcgtactcagcacgcatcttacgcccgaccgcaatggcacgaaagcctacgtgcagacc
ggaagcgttacgccgtggcgtaccattgtagtaagcgatgatgcccgcgacatcttggct
tccaaccttatcttaaacctgaacgaaccttgcaagctggcggatacctcgtggattcat
cccacgaaatatgtcggcgtatggtgggaatactttacgggacaaggctccacgtgggca
tataccgacacgcaggacatcgttatcggcaagaccgattatacgaagctgaaaccgaac
ggacaccacggagccaacacggcacacgtaaaagaatacatcgactttgcagcgaaacac
gggtttgacgccgtattggtagaaggctggaacgaaggctgggaagacaactatgcttac
agcaaggaattcatttacgatttcgacaagccctaccccgatttcgatgtagccgaactg
caacgctatgcccaggagaaaggcgtgaaaatcatcatgcaccacgaaaccacctcatcg
gtagccgactacgaacgccaaatgcacgacgccttccgctttatgaacaaatacggatac
gatgccgtaaagacgggctacgtaggtggcatcatcccgcgcagcgaacatcacgacgga
caatggatggtaaaccattatctccgcgtagcgaaaacggctgcacaatataagattatg
gtcaactcgcacgaagccgtccgccccacaggtttatgccgtacatatcccaactggatt
gcgcaggagtcggcacgcggcaccgagtttgaatccttcaaaggaaaccgccccgaccat
accactatcctgccctttacccgcctgatgggcggcccgatggactacacgcccggcatc
ttcgaaggcgacctctcgcaatacggctcgaaccaagcgaagctgagcaccacactggta
aaacagcttgccctctacgtcacgatgtatagcccgctccagatggcagccgacctgtac
caaagctacgagaaacaccttgatgccttccagttcatcaaagacgtggcggtagactgg
gacaatacctacatcctggaagccgaaccgggcgactacatcaccatagcccgcaaggcg
aaaggcaagaacgaatggtacatcggcggcatcactgacgagaatgcgcgcgaagccgtt
atcgacctcagcttcctgcccgaaggcaagaaatacgaagccaccatttatgccgacggc
aaaaaggcagactggcgcaccaatccgcaagactacgtcatctctaccaagaaagtctcc
agcaagaccatgctgaagcaacgcctcgcgcccagcggcggtgtggctatcagcattaag
gagctggaataa

DBGET integrated database retrieval system