KEGG   Bacteroides salanitronis: Bacsa_2511Help
Entry
Bacsa_2511        CDS       T01433                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bsa  Bacteroides salanitronis
Brite
Translation factors [BR:bsa03012]
 Eukaryotic Type
  Elongation factors
   Bacsa_2511
 Prokaryotic Type
   Bacsa_2511
Mitochondrial biogenesis [BR:bsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bacsa_2511
Exosome [BR:bsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bacsa_2511
  Exosomal proteins of breast cancer cells
   Bacsa_2511
  Exosomal proteins of colorectal cancer cells
   Bacsa_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ADY37049
UniProt: F0R8V0
LinkDB All DBs
Position
2919862..2921046
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLSEMRSFDSIDNAPEEKERG
ITINTAHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPRLVVFLNKCDMVDDEEMLELVEMEMRELLSFYDYDGDNTPIIRGSALGALN
GVPQWEEKVMELMDAVDSWIPLPPRDVDKPFLMPVEDVFSITGRGTVATGRIEAGRVKVG
DEVEILGLGEDKKSVVTGVEMFRKILDEGEAGDNVGLLLRGIDKNEIKRGMILCHPGQVK
AHSKFKAEVYILKKEEGGRHTPFHNHYRPQFYLRTMDCTGEISLPEGTDMVMPGDNVTIT
VELIYPVALNVGLRFAIREGGRTVGAGQITEILD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaatttgaacgttcaaaaccgcatgttaacatcggtactatcggtcac
gttgaccatggtaagactactttgaccgctgccattactacagtattggctaagaaaggt
ctctctgaaatgcgttctttcgattctatcgacaacgctcctgaagaaaaggaaagaggt
attacaatcaacactgctcacgttgaatatcagactgcaaaccgtcactatgcacacgtt
gactgtccgggacacgccgactatgtgaagaacatggtaactggtgccgctcagatggat
ggtgcaatcatcgtggttgctgcaactgatggtccgatgcctcagactcgtgaacatatc
ttgttggctcgtcaggtaaacgttccgcgtttggttgtattcttgaacaaatgcgatatg
gttgacgatgaagaaatgttggaactggtagaaatggaaatgcgcgaactgctgtcattc
tatgactacgatggtgacaacactccgattatccgtggttctgcattgggtgctttgaat
ggcgttcctcaatgggaagaaaaggtaatggaattgatggatgctgtagacagctggatt
cctctgcctccgcgtgatgtagataaaccgttcttgatgccggttgaagacgtgttctca
atcactggtcgtggtactgttgctacaggccgtatcgaagcaggtcgtgtaaaagttggc
gacgaagttgaaatcttgggtctgggcgaagacaagaaatcagttgtaactggtgttgaa
atgttccgcaagatcttggatgaaggcgaagctggtgataacgtaggtttgttgctccgt
ggtatcgacaagaacgaaatcaaacgtggtatgattttgtgtcacccgggtcaggttaag
gctcactctaagttcaaagctgaggtttatatcctgaagaaagaagaaggtggccgtcac
actccgttccacaaccactatcgtcctcagttctatctgcgtactatggactgtacaggt
gaaatctctttgccagaaggaacagacatggtaatgccgggtgataacgtaactatcact
gtagaattgatttatccggttgcattgaacgtaggtttgcgtttcgctatccgcgaaggt
ggacgtacagtaggtgctggtcagattactgaaattcttgactaa

DBGET integrated database retrieval system