KEGG   Bacillus safensis: BSL056_00440Help
Entry
BSL056_00440      CDS       T05386                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
bsaf  Bacillus safensis
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsaf03110]
    BSL056_00440
Chaperones and folding catalysts [BR:bsaf03110]
 Heat shock proteins
  HSP33
   BSL056_00440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 DUF3222
Motif
Other DBs
NCBI-ProteinID: APJ09545
LinkDB All DBs
Position
82606..83481
Genome map
AA seq 291 aa AA seqDB search
MDYLVKALAYDGKVRAYAANTTDTINEAQRRHHTWPTASAAIGRTMTATVMMGAMLKGEN
KLTVKIEGGGPIGAIIADGNAKGQVRGYVSNPQVHFDLNEHGKLDVRRAVGTSGTLSVVK
DIGLKDHFTGQTEIVSGEIGDDFTYYLVSSEQVPSSVGVGVLVNPDNSILAAGGFIIQLL
PGTEDAVIERLEKRLSTIEPISKLIEKGMTPEEILEEVLGEKPQILETVPVEFSCNCSKE
RFANGIISLGKTEIDDMIEQDGQAEAQCHFCNETYVFTKEELEELREELTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagttaaagcgttagcatatgacggaaaagtccgcgcatatgctgcaaac
acaacagatacaatcaacgaagcacaaagaagacatcatacgtggccgactgcatcagca
gccatcggcagaacgatgacagcaacagtcatgatgggtgctatgctgaaaggtgagaat
aagctaactgtcaaaatagaaggcggtggcccaatcggcgccattattgctgatggaaat
gcaaaaggccaggtgcgaggatatgtctcaaacccacaagttcactttgacttaaatgaa
catggcaagctggatgttagacgtgcagtcggaacatctggaacgttaagtgttgtcaaa
gatatcgggctgaaggaccactttacagggcaaacggaaatcgtttctggtgaaattgga
gatgacttcacttattatcttgtttcttctgagcaagtgccttcttctgtaggtgtaggc
gtccttgtcaatccagataattcgatcctcgcagcaggcggtttcatcattcaactgctg
cctggtacagaagatgctgtcattgaaagactagaaaagcgcctgtcaaccattgaacca
atctctaaactcattgaaaaagggatgacaccagaagaaatattagaagaagtactcggt
gaaaaacctcaaattttagaaactgtacctgtcgaattttcttgtaactgctccaaagaa
cggtttgcaaatggcattatcagcctaggaaaaaccgaaattgatgatatgattgaacaa
gacggacaagcagaagctcaatgccatttttgtaacgaaacgtatgtatttacaaaagaa
gagctagaagagctacgtgaagaattaacccgctag

DBGET integrated database retrieval system