KEGG   Bacillus safensis: BSL056_02500Help
Entry
BSL056_02500      CDS       T05386                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00473  D-Alanine metabolism
bsaf01100  Metabolic pathways
bsaf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSL056_02500
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BSL056_02500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsaf01011]
    BSL056_02500
Enzymes [BR:bsaf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BSL056_02500
Peptidoglycan biosynthesis and degradation proteins [BR:bsaf01011]
 Precursor biosynthesis
  Racemase
   BSL056_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C BTB_2 DUF1796
Motif
Other DBs
NCBI-ProteinID: APJ09900
LinkDB All DBs
Position
519306..520487
Genome map
AA seq 393 aa AA seqDB search
MDTNAFYRDTWAEINLTAIKHNVSHMKDHIGQNVQLMAVVKANAYGHGDIEVARAALKAG
ADLLAVAFLDEAISLRNQGIKAPILVLGAVPPEYVKTAVRYNVIMTAYSIEWLREVAHMV
KGQMGQPIRFHLKIDSGMNRLGVKTLEQVNEVKKLVSEHAYLQLEGVFTHFATADEKDEN
YFDRQVDTFQTLLQPLHTEKLLVHCANSAAGLRFKEVLFNMVRFGISMYGLSPSEEIKDE
LPFKLEEAMSLHTKLAHVKLIQKGESVSYGATYTANQDTWIGTVPVGYADGWIRKLAGTE
VLVGGKRRKIAGRVCMDQFMVELKENLPVGEPVVLIGGQGEEMVSVDEIAKRLETINYEV
TCSIGHRVPRVYIEEGKRVHVRNPLLQGGPSFF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaatgccttttatagagacacatgggcagaaattaatttaacagcaatcaag
cacaatgtttcacatatgaaagatcatataggtcaaaatgttcaattgatggctgttgtt
aaagccaatgcatatggacatggagatatagaagtggcaagagctgcactcaaagcagga
gcagacttgttagctgtagcctttttagatgaggccatttctttaagaaatcaaggcatt
aaagcaccgattcttgtactcggcgcagtaccgccggagtatgtcaaaaccgctgttcga
tacaatgtgatcatgaccgcttactccatagagtggctgagggaagtcgcccatatggtg
aaagggcagatgggacaacccattcgttttcatttgaaaatagacagcggaatgaaccgt
ttaggtgtgaaaactttagagcaagtgaatgaagtaaagaagcttgtcagcgagcatgct
tatttacagctggaaggagtatttactcactttgcgaccgcggatgaaaaggatgagaac
tattttgatcggcaggtcgacacctttcaaaccctgcttcagccgcttcatacggaaaag
ctgctcgttcattgtgccaatagtgcagcgggtttaaggtttaaagaagtgttgtttaat
atggttcgcttcggcatcagtatgtacgggctgtcgccgtcagaggaaatcaaagatgaa
cttcctttcaagctggaagaagccatgtcgcttcatacaaagcttgcccatgtaaagctc
attcaaaagggtgagagtgtcagctatggggcgacgtatacagctaatcaagatacgtgg
atcggtacggtaccagtcggctatgcagacgggtggatccggaagctggcaggcacggaa
gtacttgttggcggaaagcgccggaagattgccggaagggtatgtatggatcaattcatg
gttgaactgaaagagaaccttccagtaggggagccagtcgttttgattggtggacaaggt
gaagaaatggtatcagtcgatgaaattgcaaaaaggcttgaaaccattaactatgaagtc
acatgctccattggacaccgcgtcccaagagtatatatagaggaaggcaaaagggtacat
gtgcggaatccgctgcttcaaggcgggccaagctttttctaa

DBGET integrated database retrieval system