KEGG   Bacillus safensis: BSL056_02660
Entry
BSL056_02660      CDS       T05386                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13979  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00010  Glycolysis / Gluconeogenesis
bsaf00561  Glycerolipid metabolism
bsaf01100  Metabolic pathways
bsaf01110  Biosynthesis of secondary metabolites
bsaf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSL056_02660
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSL056_02660
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     BSL056_02660
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C NAD_binding_7 Shikimate_DH NAD_binding_2 Pyr_redox 3HCDH_N ELFV_dehydrog
Other DBs
NCBI-ProteinID: APJ09925
LinkDB
Position
complement(543956..545005)
AA seq 349 aa
MCQTHQSNVLSVSHAKANFERTTIERRALRPHDILIDIQFSGICHSDIHSAFDEWGGGIF
PMVPGHEITGVVAAVGDDVTKFQIGDRVGVGCFVDSCGTCEYCQNGDEQYCTKGVVQTYN
SRDYDGNPTYGGYSQKIVVTERFVVSIPDQLPLDAASPLLCAGITTYSPLKHWKAGPGKK
VAIVGMGGLGHVAIQFASALGAEVTVLSRSLNKKEEALSFGAKDYFATSDPETFQTLAGQ
YDLILNTVSANINVDAYLSLLRVDGTLVNVGAPPKPDQFHVFSLISGRRSIAGSLVGGIQ
ETQEMLDFAAAHNIAPQIEVINANQVDEAYERVLKSDVRYRFVIDISTL
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtgtcagacgcaccaatcaaacgttttaagtgtatcacacgccaaagcaaactttgaa
cgaacgaccattgaacgaagagcgcttcgtccacatgatattttaattgatattcaattt
agcgggatctgtcattcagatatccacagcgcttttgatgaatggggcggcggcattttc
ccgatggttccaggtcatgagattactggggtcgttgcagctgtaggagatgatgtgacg
aagtttcagatcggagaccgtgtaggcgttggctgctttgtggattcctgcggcacctgt
gaatattgtcaaaatggagacgagcagtattgcacaaaaggggtcgtccaaacgtataac
agccgtgactatgacgggaacccgacttatggcggctacagtcaaaaaattgtcgtgact
gaacgatttgtcgtcagcattcctgatcaactgccccttgatgccgcaagccctcttctc
tgtgctggcattacaacttattctccattaaagcactggaaggcaggccctggcaaaaaa
gttgctatcgtcggaatgggcgggctcggccatgttgctattcaattcgcgagtgctcta
ggcgctgaagtgacggtattgagccgctctttgaataaaaaagaagaggccctgtcattt
ggtgcaaaagactattttgctacaagtgatcctgaaacgtttcagacactagccggtcag
tacgaccttattctcaatacggtctctgccaacattaatgtggatgcctatttgtcctta
ctccgtgtagatggaaccttggtgaacgtcggtgcaccgcctaagccggatcaattccac
gtcttttcattaatttccggccgccgcagcattgctggttcactcgttggcggcatccaa
gaaacacaagaaatgctcgatttcgcagctgctcacaacatcgcaccacaaattgaagtc
atcaatgcgaatcaagttgatgaagcgtatgaacgagtgctgaaaagtgatgttcgttac
cggtttgtgattgatatttcgacgttgtga

DBGET integrated database retrieval system