KEGG   Bacillus safensis: BSL056_04675Help
Entry
BSL056_04675      CDS       T05386                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00564  Glycerophospholipid metabolism
bsaf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSL056_04675
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BSL056_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA FAD_binding_3 Pyr_redox_2 NAD_binding_8 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: APJ10276
UniProt: A0A494TUU3
LinkDB All DBs
Position
951750..953411
Genome map
AA seq 553 aa AA seqDB search
MTFSSLEREQMLQEMTKKPYDVFIIGGGITGAGTALDAASRGMRVGLAEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFSTSI
GLRVYDFLAGVKHSERRSMLSAKETLEKEPLVKKDGLKGGGYYVEYRTDDARLTIEVMKE
AVKFGAEAVNYAKVKEFIYDKGKVVGVVIEDVMTQKTYDVYAKKIVNATGPWVDQLRDKD
HSKEGKHLQHTKGIHLVFDQSVFPLKQAIYFDTPDKRMVFAIPREGKTYVGTTDTVYKKQ
LEHPRMTKADRDYVIQAIQYMFPDLNITEKDVESNWAGLRPLIHEEGKDPSEISRKDEVW
TSSSGLITIAGGKLTGYRKMAEHIVDLVRDGLKQETGKDYGPCKTKHMPISGGHVGGSKN
MAAFVQAKTAEGASVGLTEPIAQKLAEKYGSNVSSVYKRVEQLQGEADKRNIPAYVLAEL
VYAIEEELAVTPVDFFLRRTGSLLFNINWAKKYAQPVVDYMAERFGWDEAAKQKHQTELD
QLFHEAVVPLDAE
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgactttttctagcttagaaagagaacaaatgctgcaggaaatgacaaaaaaaccatat
gatgtgtttatcattggtgggggtataacaggcgctggtacagcacttgacgcggcttca
cgcggaatgcgtgtcggtcttgcagaaatgcaggatttcgcagcaggtacgtctagccgc
tcaacgaaactagtgcacggcggacttcgttatttaaaacaatttgaagtgaaaatggtc
gcagaggtcggtaaagagcgtgccattgtatacgaaaatggtcctcatgtgacaacgcca
gaatggatgcttcttccgatgcataaaggcgggacatttggtaagttttcaacctctatt
ggacttagagtgtatgactttttagctggcgtaaagcatagcgaacgcagaagcatgcta
agtgcgaaagaaacacttgaaaaagaaccgcttgtcaaaaaggacggcttaaaaggcggc
ggctactatgttgaataccgtacagatgatgcacgcctcacaattgaggtcatgaaagag
gctgtgaaattcggagcggaagcggtcaactatgcgaaagtaaaagaatttatttatgat
aaaggcaaagtggttggtgttgtcattgaagatgtcatgacgcagaaaacatacgatgtg
tatgcgaagaagatcgtcaatgcgacaggtccatgggtagatcagctgagagacaaggac
cattcaaaagaaggaaaacacttacagcatacaaaaggcattcacttagtatttgaccaa
tcggtcttcccattaaaacaagcgatttactttgacacgcctgataaacgtatggtcttt
gccattccaagagaaggcaaaacgtacgttggaacaacagatacagtgtacaaaaaacag
ctggaacacccgcgtatgacaaaagccgatcgtgactatgtcatccaagcgattcagtac
atgttccctgacctcaatattacagaaaaagatgttgaatccaactgggccggtcttcgt
ccgctcattcatgaagagggcaaagatccttcagaaatttctcgtaaagatgaagtgtgg
acatcatcttcaggcttaatcaccattgctggcggtaaattaacaggctaccgtaaaatg
gctgagcatattgtcgatctagtacgtgatggattgaaacaggagacgggcaaagattac
ggaccatgtaaaacaaagcatatgccaatctcaggcggccatgtaggcggatctaaaaac
atggcagcctttgttcaagcgaaaacagcagaaggagcatctgttggtttaacagaaccg
attgcacaaaaactagctgaaaaatatggttcaaacgtcagcagtgtctacaaacgagta
gagcagcttcaaggggaagcagacaaacgaaacattccagcatatgtgctggcagagctt
gtttatgcgatcgaagaagaactagctgtaacacctgtcgatttcttcttaagaagaaca
ggaagcctattatttaatatcaattgggcaaaaaaatacgcacagcctgttgttgactac
atggcagagcgttttggctgggatgaagcagcaaaacagaaacatcaaacagaattagat
caactattccatgaagcagtcgtaccgcttgatgctgaataa

DBGET integrated database retrieval system