KEGG   Bacillus safensis: BSL056_06190
Entry
BSL056_06190      CDS       T05386                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00040  Pentose and glucuronate interconversions
bsaf00051  Fructose and mannose metabolism
bsaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSL056_06190
   00051 Fructose and mannose metabolism
    BSL056_06190
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BSL056_06190
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C LIM TrkA_N
Other DBs
NCBI-ProteinID: APJ10562
LinkDB
Position
1241382..1242413
AA seq 343 aa
MKSAVFYSSEDIRYEERNRPVIGDDEVLLKLRACGLCGTDIYKATHETVPPGTVLGHEIA
GDIVETGKRVTNVQTGDRVYVAHHVPCFTCDFCQKGFYTMCPQFTATNVEPGGFSEYIRV
PALHVKHTMGKLPKDVSYEQGAMVEPVACCLHGFERAPVHPGDSVLILGAGQIGCIQLQL
AKYYLAGKVMITDVNENRLLQARSLGADASFHPAAEPVENRVMKETDGKGADLVIISVGS
SALLKEAFQAVARGGTILVFAHFPKGDVAIPAERFFNDEVKVVGAYSSHPYHYREALELL
KAKVVNTEKMVTHRYPLSQLLQAIECARHPEGESVKIMMYPDE
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaaatcagctgtcttttattcttcagaggacattcggtatgaggagcggaaccggcca
gtcatcggtgatgatgaagttctgttaaagctgcgagcctgcggcttatgcggaacggat
atttacaaagcaacgcatgagacagtacctcctgggacagtgctggggcatgaaatcgct
ggtgatattgtcgagactggcaagcgtgtgacaaatgtccagacgggagacagggtttat
gtggcgcatcatgtgccttgtttcacctgtgacttttgtcaaaaggggttttatacgatg
tgtccgcagtttacagccacaaatgtagagccgggcgggttttcagaatatatccgtgta
cctgctttgcatgtcaagcacacgatgggcaagcttccaaaagatgtatcgtatgagcaa
ggggcgatggtagaaccggtagcctgctgtctgcatgggtttgagcgagctcctgttcat
ccaggagattccgtcttgatccttggagcggggcaaattggctgtattcaattgcagctc
gccaaatattatttggctgggaaagtgatgataacagatgtgaatgagaacaggctgctg
caagcgaggagtttaggtgcagacgcctccttccatccagcagctgagccggttgaaaac
cgggtgatgaaagaaacagatggaaagggagcagacctcgtcattatttctgttgggagc
agtgcgcttttaaaagaagcgtttcaggctgtagcgcgaggcgggacgattttggtgttt
gctcattttccaaagggagatgtggccattcctgctgaacgatttttcaatgatgaagtg
aaggtagtaggagcctattcctcgcatccatatcattatcgtgaagcccttgagcttttg
aaagcaaaagtggtcaacactgaaaagatggtgacgcatcgttatccattaagccagctg
cttcaggcgatagaatgtgcgaggcatcctgagggtgagagcgtcaaaatcatgatgtat
ccagatgaatga

DBGET integrated database retrieval system