KEGG   Bacillus safensis: BSL056_08325Help
Entry
BSL056_08325      CDS       T05386                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00260  Glycine, serine and threonine metabolism
bsaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSL056_08325
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     BSL056_08325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C MTS UDPG_MGDP_dh_N Methyltransf_25 TrkA_N
Motif
Other DBs
NCBI-ProteinID: APJ10964
LinkDB All DBs
Position
1668436..1669500
Genome map
AA seq 354 aa AA seqDB search
MCGTMKAIVKKESAYGAVLMEMPIPEIKDHEVLIQVKATSICGTDVHIYNWDDWAKGRVK
APYIFGHEFTGEVVKVGKQVSRAKVGDFVSAETHVVCNQCYMCLTGQQHLCSETKILGVD
IDGCFAEYVKVPEQNVWHNPAQMPVELASIQEPLGNAVHTVLHTPVSGKSVAIFGCGPIG
LMAIAVAKASGAVQVFAVDKNEYRLDLARKMGADHIVDIGKGDPVAIIKQLTRMEGADVM
CEMSGHPAAINQALEACANGGKVNILSLPERPVTIDITNQIVFRGLTVQGITGRKMFETW
RQVSELLRTNTIDVKPVVTHTLPFEEFEKGFELMQSGTCGKVVLMMPSYQRGKK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaacgatgaaagcaattgttaaaaaagaaagcgcttacggagcggtgttgatg
gagatgccgattccagaaatcaaagatcatgaagttttgatccaagtgaaagccacttcg
atatgcggaacagacgtgcatatttataattgggatgactgggctaagggaagagtcaaa
gcgccttacatttttggacatgaatttacaggggaagttgttaaagtggggaagcaggtc
tcacgagcaaaggtaggggactttgtatcagctgagacgcatgttgtatgtaatcaatgt
tatatgtgcttaacagggcagcagcatttgtgcagtgaaacgaaaattttaggggtagac
attgatggctgttttgctgaatatgtcaaagtgcctgaacaaaatgtgtggcacaatcca
gctcaaatgccggttgagcttgcctctatacaagagccgctaggaaatgctgttcatact
gtactgcacacacctgtttcaggtaagtcagtggcgatttttggctgcggaccaataggt
ttaatggcaatcgctgttgcaaaagcctccggggctgttcaagtgttcgctgttgataaa
aatgaatacaggctcgatcttgcccggaaaatgggtgcagatcatatcgtggatattgga
aaaggtgatccagtcgcgataattaagcagctcacgcggatggaaggggcagatgtgatg
tgtgagatgtcaggtcatccagctgccattaatcaagcactcgaagcttgtgcaaatgga
gggaaagtcaatatactaagcttgccagaacggccagtaacaattgatattacgaatcaa
attgtttttaggggattaaccgtacaagggatcacggggagaaaaatgtttgagacgtgg
cgtcaagtatctgagctattaagaacgaataccattgatgtaaaaccagttgtcactcat
acactgccatttgaagagttcgaaaagggatttgaacttatgcaaagcggtacgtgcggg
aaagtcgtactgatgatgccatcatatcaaagggggaagaaatga

DBGET integrated database retrieval system