KEGG   Bacillus safensis: BSL056_08470Help
Entry
BSL056_08470      CDS       T05386                                 

Definition
(GenBank) class 1b ribonucleoside-diphosphate reductase subunit beta
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00230  Purine metabolism
bsaf00240  Pyrimidine metabolism
bsaf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSL056_08470
   00240 Pyrimidine metabolism
    BSL056_08470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsaf03400]
    BSL056_08470
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BSL056_08470
DNA repair and recombination proteins [BR:bsaf03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSL056_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm DUF2247 DUF1464
Motif
Other DBs
NCBI-ProteinID: APJ10992
UniProt: A0A0M2EC54
LinkDB All DBs
Position
1694123..1695103
Genome map
AA seq 326 aa AA seqDB search
MTKIYDAANWSKHEDDFTQMFYNQNVKQFWLPEEISLNGDLLTWKYLGEKERDTYMKVLA
GLTLLDTEQGNTGMPIVAEHVDGHQRKAVLNFMAMMENAVHAKSYSNIFMTLAPTETISE
VFEWVKKNKFLQKKADMIVSLYRSIQKDDPISLFKAMVASVYLESFLFYSGFYYPLYFYG
QGKLMQSGEIINLILRDEAIHGVYVGLLAQEIYNKQTPDVQKELYDFSIDLLNELYENEL
HYTEDIYDQVNLSHDVKKFIRYNANKALMNLGFAPYFEEEEINPIVLNGLNTKTKSHDFF
SMKGNGYKKATVEPLKDDDFFFGDES
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaatttatgatgcagccaactggtcaaaacacgaagacgattttacacaaatg
ttttacaaccaaaatgtaaagcagttctggcttccagaagagatttccttaaacggcgat
ctcttaacatggaaatatttaggtgaaaaagagcgagatacgtatatgaaggtacttgct
ggactgactttacttgatacagaacaaggaaatacagggatgccgattgttgctgaacat
gtggacggccatcagcgtaaagctgtactcaactttatggcaatgatggaaaatgcggtg
catgcgaaatcatactcaaatatcttcatgacactcgcaccaactgaaacgatcagtgaa
gtgtttgaatgggtcaagaagaataaattcctgcaaaagaaagcagatatgattgtcagt
ttataccgttcgattcaaaaggacgatcctatttctctctttaaagcaatggttgcttct
gtttatttagagagtttcctattttatagtggtttttactacccgctttatttctatgga
caaggaaagctcatgcaaagtggtgaaatcatcaacttaattttgcgtgatgaagcgatt
catggtgtgtacgttggattattagcacaagaaatttacaacaaacaaacacctgacgtg
caaaaagagctgtatgatttctctattgaccttttaaacgagctttatgaaaatgaactt
cattacactgaagatatttatgaccaagtcaatttatcgcatgatgtgaaaaagtttatt
cgttacaatgccaataaagcgttaatgaaccttggatttgccccttactttgaagaagaa
gagattaaccctattgtattgaatggactcaatacaaaaacaaagtcgcatgacttcttc
tcaatgaaagggaacggctacaaaaaagcaacagttgagccgttaaaagatgacgacttc
ttctttggagatgaatcataa

DBGET integrated database retrieval system