KEGG   Bacillus safensis: BSL056_10030Help
Entry
BSL056_10030      CDS       T05386                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00010  Glycolysis / Gluconeogenesis
bsaf00053  Ascorbate and aldarate metabolism
bsaf00071  Fatty acid degradation
bsaf00280  Valine, leucine and isoleucine degradation
bsaf00310  Lysine degradation
bsaf00330  Arginine and proline metabolism
bsaf00340  Histidine metabolism
bsaf00380  Tryptophan metabolism
bsaf00410  beta-Alanine metabolism
bsaf00561  Glycerolipid metabolism
bsaf00620  Pyruvate metabolism
bsaf00625  Chloroalkane and chloroalkene degradation
bsaf01100  Metabolic pathways
bsaf01110  Biosynthesis of secondary metabolites
bsaf01120  Microbial metabolism in diverse environments
bsaf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSL056_10030
   00053 Ascorbate and aldarate metabolism
    BSL056_10030
   00620 Pyruvate metabolism
    BSL056_10030
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSL056_10030
   00561 Glycerolipid metabolism
    BSL056_10030
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSL056_10030
   00310 Lysine degradation
    BSL056_10030
   00330 Arginine and proline metabolism
    BSL056_10030
   00340 Histidine metabolism
    BSL056_10030
   00380 Tryptophan metabolism
    BSL056_10030
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSL056_10030
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BSL056_10030
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSL056_10030
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BSL056_10030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh MtaB
Motif
Other DBs
NCBI-ProteinID: APJ11274
UniProt: A0A2B6L9R1
LinkDB All DBs
Position
1953407..1954834
Genome map
AA seq 475 aa AA seqDB search
MRNQEKHFINGEWIASTGNETTEVINPATEEVIGTISLGTKEDLDKAVKAARAAFPSFSK
TSRNERVKMLENIVRGYEKRKDELIEVMTQELGAPLKVSEEVHYKMGHEHFSKAAEALKS
YTFTEDRGGHTIIKEAIGVSGLITPWNFPTNQTSLKIAGAIAAGSPVVLKPAEITPFAAM
ILADIIDEAGVPKGVFNLVNGTGDVIGDGISSHPDIDFVSFTGSGAVGSKIMENAADNIK
KVALELGGKSPLIVLDDADVDEAAETAVHHIAMNTGQVCSAATRVLIPESMKDAFEKALL
NALPKFTVGDPREDHATGPLVSKKQWDTVQSYIEKGIEEGAHLLAGGTGKPDGLDKGYFA
KHTIFTNVKNDMTIAQEEIFGPVMSVITYQDLDHALEIANDTVYGLAGYVVGKDEKTLKY
VAEHIRAGQITINNAETDYFAPFGGFKQSGIGREWGDFGIEEYLEVKAVMGLPTA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcaagagaaacattttattaacggagaatggatcgcatcaacaggaaacgaa
acgacggaagtcatcaatcctgctacagaggaagtcattggcaccattagtttaggaaca
aaagaagatttagacaaggcagtcaaagcagctcgtgccgccttcccttctttctcaaaa
acatctcgaaatgaacgcgtaaagatgctggaaaacattgtgcgcggctacgaaaagcgt
aaggatgaactaattgaagtcatgacacaagagctcggtgcaccgctgaaagtatcggaa
gaggttcattacaaaatgggacatgaacatttttctaaagcagcggaagcacttaaatcg
tatacatttactgaggaccgcggcggacacaccattataaaagaagcgattggtgtcagc
ggattgattacaccttggaatttcccaacaaatcaaacatcacttaaaatcgcgggtgcc
attgcagcaggctcgccagttgtcttaaagcctgcggaaattacgccttttgccgcaatg
attcttgcagacatcattgatgaagctggcgtaccgaaaggcgtcttcaacctagtaaac
ggaactggtgatgtcattggtgacggcattagctcacaccctgatattgactttgtttca
tttacgggatcaggtgctgtcggctctaaaataatggaaaatgctgcagacaatattaag
aaagtggctcttgagctcggcgggaaatcccctcttatcgtcttagatgatgcagatgtg
gatgaggcagccgaaacagccgttcatcatattgcgatgaatacaggtcaagtatgttcc
gcagctacacgtgtgctgattcctgaatcaatgaaagacgcatttgaaaaagcgctgctg
aatgccctgccgaagtttacagttggtgatccgcgagaagatcacgccactggcccgctt
gtctccaaaaagcaatgggataccgtgcagtcttatattgaaaaaggaattgaagaaggt
gctcacctacttgctgggggaactggtaagccggacggactagacaaaggatatttcgct
aaacatactattttcacaaatgtgaaaaatgatatgaccattgcgcaagaggaaatattc
ggacccgtcatgagtgtgatcacatatcaagacctggatcatgcccttgagattgccaat
gatacagtgtacggtcttgctggctatgtggttggaaaagatgaaaaaacattaaaatat
gtagctgaacatattcgtgccggtcaaattaccattaacaatgccgaaacagattacttt
gccccgtttggcggctttaagcaatctggtatcggaagagaatggggagacttcggtatc
gaggaatatttagaagtgaaagccgtgatgggacttccaacagcataa

DBGET integrated database retrieval system