KEGG   Bacillus safensis: BSL056_12940
Entry
BSL056_12940      CDS       T05386                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00625  Chloroalkane and chloroalkene degradation
bsaf00680  Methane metabolism
bsaf01100  Metabolic pathways
bsaf01120  Microbial metabolism in diverse environments
bsaf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BSL056_12940
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BSL056_12940
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     BSL056_12940
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3 FAD_binding_2 Pyr_redox_3
Other DBs
NCBI-ProteinID: APJ11814
UniProt: A0A5C0WK28
LinkDB
Position
complement(2494491..2495705)
AA seq 404 aa
MSGNKGVVYKGAGKVAVEDIGYPDLVLKDGPGVPKANVGRKCEHGVILKVVTTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVVEVGRDVEFIQKGDLVSVPFNIACGRCVMCKEQKTHV
CLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLKFPDKDQAMEKILDLTMLSDI
FPTGFHGAYTAGVKPGSTVYIAGAGPVGLAAAHSAQLLGASAVIVGDLNEQRLEQARSFG
CETINLRKHDRIGEQITNILGEPEVDCAVDCVGFEASGHGDQGEAPATVLNTIMDITKVG
GKLGIPGLYVTEDPGAVDADAKVGSLKVRIGLGWAKAHTFVTGQTPVMQYHRSLMKSILS
GRAQIAKAVNATVIDLDQAPKGYSDFDSGVAKKFVIDPHGMLSR
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcgggaaacaaaggtgtcgtttataaaggagcaggaaaagtagcagttgaggatatt
ggataccctgatttggtcttaaaagacggcccgggtgtacctaaagccaatgtggggcgc
aaatgtgagcatggcgtcattttaaaagtagtgacgacgaatatttgcggaagtgatcag
cacatggtgagagggcgtacgactgcacctgaaggacttgtccttggtcatgaaattaca
ggtgaagtcgtggaagttgggcgagatgtagagtttattcaaaaaggagatctcgtgtcc
gttccgtttaatattgcatgcggacgctgcgtcatgtgtaaggaacaaaaaacccatgtg
tgcttaaatgtaaacccggaccgcccaggctctgcctatggatatgtagatatgggcgga
tgggttggcggccaatccgagtatgtcatggttccatatgcagattttcaactgctcaaa
tttccagacaaagatcaagcgatggaaaaaatacttgatctcacgatgctttccgatatt
ttcccgacaggttttcatggtgcttatacggctggagtaaagcctggttcgaccgtatat
attgcaggtgctgggccagtaggtcttgcagcagcacattcggctcaacttcttggcgca
tctgctgtgattgttggagatctgaatgagcaaagactggaacaggcaagaagcttcggc
tgtgagacgatcaatctacgaaaacatgatcgaatcggcgaacaaattacgaatatttta
ggggagccagaagttgattgtgccgtcgattgtgtcggctttgaagcttcgggtcatgga
gaccagggagaagcaccagcaactgttttaaatacgattatggatattaccaaagttggc
ggcaagcttggaattccagggctttatgtcacagaagatccaggagcagtggatgccgat
gcaaaagtcggttctctgaaagtgcgaattggacttggctgggcgaaagctcataccttt
gtgacaggtcaaacccctgttatgcaatatcatcgcagtctaatgaaatccattttaagc
ggcagagcacagatcgctaaagccgtcaatgcgaccgtcattgaccttgatcaagcccct
aaaggatatagtgactttgattcgggtgtggcgaagaaatttgtcattgacccgcacggg
atgctttctcgataa

DBGET integrated database retrieval system