KEGG   Bacillus safensis: BSL056_14485Help
Entry
BSL056_14485      CDS       T05386                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsaf  Bacillus safensis
Pathway
bsaf00020  Citrate cycle (TCA cycle)
bsaf00480  Glutathione metabolism
bsaf01100  Metabolic pathways
bsaf01110  Biosynthesis of secondary metabolites
bsaf01120  Microbial metabolism in diverse environments
bsaf01130  Biosynthesis of antibiotics
bsaf01200  Carbon metabolism
bsaf01210  2-Oxocarboxylic acid metabolism
bsaf01230  Biosynthesis of amino acids
Module
bsaf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsaf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSL056_14485
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSL056_14485
Enzymes [BR:bsaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BSL056_14485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: APJ12096
UniProt: A0A0M2EB12
LinkDB All DBs
Position
complement(2806529..2807800)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVTGGVLNVPNNPIIPFIEGDGIGPDIWKAASRVLEAAVEKAYKGEKQITWKE
VYAGEKAYNKTGEWLPEQTLEDIREYLIAIKGPLTTPIGGGIRSLNVALRQELDLFTCLR
PVRWFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSDEVKKLIDFLKNELGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIQYAIDQGRKSVTLVHKGNIMKFTEGAFKNWGYEVA
EKEFGDKVFTWAQYDRIVEQDGKDAANKAQSEAEAAGKIIVKDSIADIFLQQILTRPAEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWQEAADLVIQSVEKTIASKVVTYDFARLMDGATEVKCSEFADELIK
NLS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacaaggcgaaaaaattacagttactggcggcgtattgaatgtaccaaataatcca
attatcccgtttatcgaaggggacggaatcggtcctgacatttggaaagcagcatcaaga
gtacttgaagcagctgtagaaaaagcatataaaggtgaaaagcaaatcacttggaaagaa
gtatatgcaggtgagaaagcttacaataaaactggagagtggcttcctgagcaaacgctt
gaagacattcgtgaatacttaattgcgattaaaggaccactaacaacaccaattggcgga
ggaatccgttcattaaacgtggcacttagacaagagcttgatttattcacatgcttacgt
cctgttcgctggttcaaaggggtaccttctcctgtgaaacgtccagaagacacagatatg
gtgatcttccgtgagaacacagaagatatctatgctggtatcgagtatgcaaaaggttca
gacgaagtgaagaagttaattgacttcttgaaaaacgaattaggtgtgaacaaaatccgt
ttcccagaaacgtcaggtatcggaatcaagccagtttctgaagagggtacatcccgtctt
gtcagagcggctatccaatatgcaattgaccaaggccgtaaatctgtgacgcttgttcac
aaaggaaacatcatgaaatttacagaaggtgccttcaaaaactggggctacgaagtggct
gaaaaagagtttggcgacaaggtctttacatgggcacaatatgatcgtattgtagaacaa
gatggaaaagatgcggcaaacaaagcgcaaagtgaagcagaagctgctggcaaaatcatt
gtcaaagacagcattgcagatattttccttcaacaaatcttaactcgtccagctgagttc
gatgttgtggctacaatgaacttaaatggagattacatctctgatgcacttgcagcacaa
gttggtggaattggtatcgcacctggtgcgaacatcaactacgaaacaggacacgctatt
tttgaagcgactcacggaacagcaccaaaatatgctggtcttgataaagtgaatccatct
tctgttcttctatcaggcgtgcttttacttgagcaccttggctggcaggaagcagctgat
ctagtgattcaatctgttgaaaaaacaattgcatctaaagtcgtcacatacgattttgct
agattaatggatggcgcaacagaagtaaaatgttctgagtttgctgacgagctcatcaaa
aacttgtcttga

DBGET integrated database retrieval system